Placeholder image of a protein
Icon representing a puzzle

1124: Revisiting Puzzle 86: Nematode

Closed since over 10 years ago

Intermediate Overall Prediction

Summary

Created
August 11, 2015
Expires
Max points
100
Description

This is a throwback puzzle to the early days of Foldit. This protein, isolated from the hookworm A. caninum, is an extremely potent anticoagulant. This protein contains ten cysteine residues that oxidize to form five disulfide bonds. We are revisiting old Foldit puzzles so we can see how useful the recent additions to the game have been.



Sequence:

KATMQCGENEKYDSCGSKECDKKCKYDGVEEEDDEEPNVPCLVRVCHQDCVCEEGFYRNKDDKCVSAEDCELDNMDFIYPGTRNP

Top groups

  1. Avatar for xkcd 11. xkcd 3 pts. 9,103
  2. Avatar for Natural Abilities 12. Natural Abilities 2 pts. 9,085
  3. Avatar for Italiani Al Lavoro 13. Italiani Al Lavoro 1 pt. 8,922
  4. Avatar for FoldIt@Netherlands 14. FoldIt@Netherlands 1 pt. 8,253
  5. Avatar for BOINC@Poland 15. BOINC@Poland 1 pt. 8,250
  6. Avatar for freefolder 16. freefolder 1 pt. 8,235
  7. Avatar for Eὕρηκα! Heureka! 17. Eὕρηκα! Heureka! 1 pt. 7,400
  8. Avatar for ROMANIA Team 18. ROMANIA Team 1 pt. 7,368
  9. Avatar for CureCoin 19. CureCoin 1 pt. 6,771
  10. Avatar for DSN @ Home 20. DSN @ Home 1 pt. 6,661
  1. Avatar for Lindata 91. Lindata Lv 1 10 pts. 8,702
  2. Avatar for Colostomy EXPLOSION. 92. Colostomy EXPLOSION. Lv 1 10 pts. 8,682
  3. Avatar for Pro Lapser 93. Pro Lapser Lv 1 9 pts. 8,652
  4. Avatar for TJOK fan 94. TJOK fan Lv 1 9 pts. 8,606
  5. Avatar for gurch 95. gurch Lv 1 9 pts. 8,576
  6. Avatar for Merf 96. Merf Lv 1 8 pts. 8,561
  7. Avatar for Simek 97. Simek Lv 1 8 pts. 8,547
  8. Avatar for brgreening 98. brgreening Lv 1 8 pts. 8,511
  9. Avatar for pmthomson90 99. pmthomson90 Lv 1 8 pts. 8,502
  10. Avatar for tallguy-13088 100. tallguy-13088 Lv 1 7 pts. 8,471

Comments