Placeholder image of a protein
Icon representing a puzzle

1124: Revisiting Puzzle 86: Nematode

Closed since over 10 years ago

Intermediate Overall Prediction

Summary

Created
August 11, 2015
Expires
Max points
100
Description

This is a throwback puzzle to the early days of Foldit. This protein, isolated from the hookworm A. caninum, is an extremely potent anticoagulant. This protein contains ten cysteine residues that oxidize to form five disulfide bonds. We are revisiting old Foldit puzzles so we can see how useful the recent additions to the game have been.



Sequence:

KATMQCGENEKYDSCGSKECDKKCKYDGVEEEDDEEPNVPCLVRVCHQDCVCEEGFYRNKDDKCVSAEDCELDNMDFIYPGTRNP

Top groups

  1. Avatar for xkcd 11. xkcd 3 pts. 9,103
  2. Avatar for Natural Abilities 12. Natural Abilities 2 pts. 9,085
  3. Avatar for Italiani Al Lavoro 13. Italiani Al Lavoro 1 pt. 8,922
  4. Avatar for FoldIt@Netherlands 14. FoldIt@Netherlands 1 pt. 8,253
  5. Avatar for BOINC@Poland 15. BOINC@Poland 1 pt. 8,250
  6. Avatar for freefolder 16. freefolder 1 pt. 8,235
  7. Avatar for Eὕρηκα! Heureka! 17. Eὕρηκα! Heureka! 1 pt. 7,400
  8. Avatar for ROMANIA Team 18. ROMANIA Team 1 pt. 7,368
  9. Avatar for CureCoin 19. CureCoin 1 pt. 6,771
  10. Avatar for DSN @ Home 20. DSN @ Home 1 pt. 6,661
  1. Avatar for SKSbell 101. SKSbell Lv 1 7 pts. 8,465
  2. Avatar for pizpot 102. pizpot Lv 1 7 pts. 8,458
  3. Avatar for JUMELLE54 103. JUMELLE54 Lv 1 7 pts. 8,440
  4. Avatar for phi16 104. phi16 Lv 1 6 pts. 8,415
  5. Avatar for Superphosphate 105. Superphosphate Lv 1 6 pts. 8,394
  6. Avatar for weitzen 106. weitzen Lv 1 6 pts. 8,386
  7. Avatar for proteansoup 107. proteansoup Lv 1 6 pts. 8,381
  8. Avatar for atimeswift 108. atimeswift Lv 1 6 pts. 8,370
  9. Avatar for telesphore4 109. telesphore4 Lv 1 5 pts. 8,335
  10. Avatar for froggs554 110. froggs554 Lv 1 5 pts. 8,313

Comments