Placeholder image of a protein
Icon representing a puzzle

1124: Revisiting Puzzle 86: Nematode

Closed since over 10 years ago

Intermediate Overall Prediction

Summary

Created
August 11, 2015
Expires
Max points
100
Description

This is a throwback puzzle to the early days of Foldit. This protein, isolated from the hookworm A. caninum, is an extremely potent anticoagulant. This protein contains ten cysteine residues that oxidize to form five disulfide bonds. We are revisiting old Foldit puzzles so we can see how useful the recent additions to the game have been.



Sequence:

KATMQCGENEKYDSCGSKECDKKCKYDGVEEEDDEEPNVPCLVRVCHQDCVCEEGFYRNKDDKCVSAEDCELDNMDFIYPGTRNP

Top groups

  1. Avatar for xkcd 11. xkcd 3 pts. 9,103
  2. Avatar for Natural Abilities 12. Natural Abilities 2 pts. 9,085
  3. Avatar for Italiani Al Lavoro 13. Italiani Al Lavoro 1 pt. 8,922
  4. Avatar for FoldIt@Netherlands 14. FoldIt@Netherlands 1 pt. 8,253
  5. Avatar for BOINC@Poland 15. BOINC@Poland 1 pt. 8,250
  6. Avatar for freefolder 16. freefolder 1 pt. 8,235
  7. Avatar for Eὕρηκα! Heureka! 17. Eὕρηκα! Heureka! 1 pt. 7,400
  8. Avatar for ROMANIA Team 18. ROMANIA Team 1 pt. 7,368
  9. Avatar for CureCoin 19. CureCoin 1 pt. 6,771
  10. Avatar for DSN @ Home 20. DSN @ Home 1 pt. 6,661
  1. Avatar for navn 131. navn Lv 1 2 pts. 7,910
  2. Avatar for matosfran 132. matosfran Lv 1 2 pts. 7,883
  3. Avatar for tela 133. tela Lv 1 2 pts. 7,839
  4. Avatar for lamoille 134. lamoille Lv 1 2 pts. 7,839
  5. Avatar for johngran 135. johngran Lv 1 2 pts. 7,803
  6. Avatar for senor pit 136. senor pit Lv 1 2 pts. 7,790
  7. Avatar for armaholik 137. armaholik Lv 1 2 pts. 7,781
  8. Avatar for mitarcher 138. mitarcher Lv 1 2 pts. 7,769
  9. Avatar for Reldas 139. Reldas Lv 1 2 pts. 7,763
  10. Avatar for dettingen 140. dettingen Lv 1 2 pts. 7,753

Comments