Placeholder image of a protein
Icon representing a puzzle

1124: Revisiting Puzzle 86: Nematode

Closed since over 10 years ago

Intermediate Overall Prediction

Summary

Created
August 11, 2015
Expires
Max points
100
Description

This is a throwback puzzle to the early days of Foldit. This protein, isolated from the hookworm A. caninum, is an extremely potent anticoagulant. This protein contains ten cysteine residues that oxidize to form five disulfide bonds. We are revisiting old Foldit puzzles so we can see how useful the recent additions to the game have been.



Sequence:

KATMQCGENEKYDSCGSKECDKKCKYDGVEEEDDEEPNVPCLVRVCHQDCVCEEGFYRNKDDKCVSAEDCELDNMDFIYPGTRNP

Top groups

  1. Avatar for xkcd 11. xkcd 3 pts. 9,103
  2. Avatar for Natural Abilities 12. Natural Abilities 2 pts. 9,085
  3. Avatar for Italiani Al Lavoro 13. Italiani Al Lavoro 1 pt. 8,922
  4. Avatar for FoldIt@Netherlands 14. FoldIt@Netherlands 1 pt. 8,253
  5. Avatar for BOINC@Poland 15. BOINC@Poland 1 pt. 8,250
  6. Avatar for freefolder 16. freefolder 1 pt. 8,235
  7. Avatar for Eὕρηκα! Heureka! 17. Eὕρηκα! Heureka! 1 pt. 7,400
  8. Avatar for ROMANIA Team 18. ROMANIA Team 1 pt. 7,368
  9. Avatar for CureCoin 19. CureCoin 1 pt. 6,771
  10. Avatar for DSN @ Home 20. DSN @ Home 1 pt. 6,661
  1. Avatar for DScott 151. DScott Lv 1 1 pt. 7,575
  2. Avatar for pfeiffelfloyd 152. pfeiffelfloyd Lv 1 1 pt. 7,570
  3. Avatar for sergiodana 153. sergiodana Lv 1 1 pt. 7,558
  4. Avatar for mirjamvandelft 154. mirjamvandelft Lv 1 1 pt. 7,516
  5. Avatar for jencimons 155. jencimons Lv 1 1 pt. 7,503
  6. Avatar for FreeFolder 156. FreeFolder Lv 1 1 pt. 7,491
  7. Avatar for Udjine 157. Udjine Lv 1 1 pt. 7,466
  8. Avatar for cynwulf28 158. cynwulf28 Lv 1 1 pt. 7,455
  9. Avatar for tymaja 159. tymaja Lv 1 1 pt. 7,440
  10. Avatar for bwkittitas 160. bwkittitas Lv 1 1 pt. 7,438

Comments