Placeholder image of a protein
Icon representing a puzzle

1124: Revisiting Puzzle 86: Nematode

Closed since over 10 years ago

Intermediate Overall Prediction

Summary


Created
August 11, 2015
Expires
Max points
100
Description

This is a throwback puzzle to the early days of Foldit. This protein, isolated from the hookworm A. caninum, is an extremely potent anticoagulant. This protein contains ten cysteine residues that oxidize to form five disulfide bonds. We are revisiting old Foldit puzzles so we can see how useful the recent additions to the game have been.



Sequence:

KATMQCGENEKYDSCGSKECDKKCKYDGVEEEDDEEPNVPCLVRVCHQDCVCEEGFYRNKDDKCVSAEDCELDNMDFIYPGTRNP

Top groups


  1. Avatar for xkcd 11. xkcd 3 pts. 9,103
  2. Avatar for Natural Abilities 12. Natural Abilities 2 pts. 9,085
  3. Avatar for Italiani Al Lavoro 13. Italiani Al Lavoro 1 pt. 8,922
  4. Avatar for FoldIt@Netherlands 14. FoldIt@Netherlands 1 pt. 8,253
  5. Avatar for BOINC@Poland 15. BOINC@Poland 1 pt. 8,250
  6. Avatar for freefolder 16. freefolder 1 pt. 8,235
  7. Avatar for Eὕρηκα! Heureka! 17. Eὕρηκα! Heureka! 1 pt. 7,400
  8. Avatar for ROMANIA Team 18. ROMANIA Team 1 pt. 7,368
  9. Avatar for CureCoin 19. CureCoin 1 pt. 6,771
  10. Avatar for DSN @ Home 20. DSN @ Home 1 pt. 6,661

  1. Avatar for Savas 161. Savas Lv 1 1 pt. 7,400
  2. Avatar for parsnip 162. parsnip Lv 1 1 pt. 7,379
  3. Avatar for PuccaRO 163. PuccaRO Lv 1 1 pt. 7,368
  4. Avatar for GreekCivilization 164. GreekCivilization Lv 1 1 pt. 7,364
  5. Avatar for martinf 165. martinf Lv 1 1 pt. 7,359
  6. Avatar for val.sch67 166. val.sch67 Lv 1 1 pt. 7,328
  7. Avatar for Duke_K 167. Duke_K Lv 1 1 pt. 7,326
  8. Avatar for rezaefar 168. rezaefar Lv 1 1 pt. 7,317
  9. Avatar for Tyggy Too 169. Tyggy Too Lv 1 1 pt. 7,305
  10. Avatar for Inkedhands 170. Inkedhands Lv 1 1 pt. 7,294

Comments