Placeholder image of a protein
Icon representing a puzzle

1124: Revisiting Puzzle 86: Nematode

Closed since over 10 years ago

Intermediate Overall Prediction

Summary

Created
August 11, 2015
Expires
Max points
100
Description

This is a throwback puzzle to the early days of Foldit. This protein, isolated from the hookworm A. caninum, is an extremely potent anticoagulant. This protein contains ten cysteine residues that oxidize to form five disulfide bonds. We are revisiting old Foldit puzzles so we can see how useful the recent additions to the game have been.



Sequence:

KATMQCGENEKYDSCGSKECDKKCKYDGVEEEDDEEPNVPCLVRVCHQDCVCEEGFYRNKDDKCVSAEDCELDNMDFIYPGTRNP

Top groups

  1. Avatar for xkcd 11. xkcd 3 pts. 9,103
  2. Avatar for Natural Abilities 12. Natural Abilities 2 pts. 9,085
  3. Avatar for Italiani Al Lavoro 13. Italiani Al Lavoro 1 pt. 8,922
  4. Avatar for FoldIt@Netherlands 14. FoldIt@Netherlands 1 pt. 8,253
  5. Avatar for BOINC@Poland 15. BOINC@Poland 1 pt. 8,250
  6. Avatar for freefolder 16. freefolder 1 pt. 8,235
  7. Avatar for Eὕρηκα! Heureka! 17. Eὕρηκα! Heureka! 1 pt. 7,400
  8. Avatar for ROMANIA Team 18. ROMANIA Team 1 pt. 7,368
  9. Avatar for CureCoin 19. CureCoin 1 pt. 6,771
  10. Avatar for DSN @ Home 20. DSN @ Home 1 pt. 6,661
  1. Avatar for karost 171. karost Lv 1 1 pt. 7,292
  2. Avatar for stzari 172. stzari Lv 1 1 pt. 7,280
  3. Avatar for cor2020 173. cor2020 Lv 1 1 pt. 7,272
  4. Avatar for poiuyqwert 174. poiuyqwert Lv 1 1 pt. 7,249
  5. Avatar for trentis1 175. trentis1 Lv 1 1 pt. 7,230
  6. Avatar for v4mp1r3 176. v4mp1r3 Lv 1 1 pt. 7,226
  7. Avatar for roman madala 177. roman madala Lv 1 1 pt. 7,220
  8. Avatar for zezetel 178. zezetel Lv 1 1 pt. 7,213
  9. Avatar for polly66017 179. polly66017 Lv 1 1 pt. 7,205
  10. Avatar for psen 180. psen Lv 1 1 pt. 7,202

Comments