Placeholder image of a protein
Icon representing a puzzle

1124: Revisiting Puzzle 86: Nematode

Closed since over 10 years ago

Intermediate Overall Prediction

Summary

Created
August 11, 2015
Expires
Max points
100
Description

This is a throwback puzzle to the early days of Foldit. This protein, isolated from the hookworm A. caninum, is an extremely potent anticoagulant. This protein contains ten cysteine residues that oxidize to form five disulfide bonds. We are revisiting old Foldit puzzles so we can see how useful the recent additions to the game have been.



Sequence:

KATMQCGENEKYDSCGSKECDKKCKYDGVEEEDDEEPNVPCLVRVCHQDCVCEEGFYRNKDDKCVSAEDCELDNMDFIYPGTRNP

Top groups

  1. Avatar for xkcd 11. xkcd 3 pts. 9,103
  2. Avatar for Natural Abilities 12. Natural Abilities 2 pts. 9,085
  3. Avatar for Italiani Al Lavoro 13. Italiani Al Lavoro 1 pt. 8,922
  4. Avatar for FoldIt@Netherlands 14. FoldIt@Netherlands 1 pt. 8,253
  5. Avatar for BOINC@Poland 15. BOINC@Poland 1 pt. 8,250
  6. Avatar for freefolder 16. freefolder 1 pt. 8,235
  7. Avatar for Eὕρηκα! Heureka! 17. Eὕρηκα! Heureka! 1 pt. 7,400
  8. Avatar for ROMANIA Team 18. ROMANIA Team 1 pt. 7,368
  9. Avatar for CureCoin 19. CureCoin 1 pt. 6,771
  10. Avatar for DSN @ Home 20. DSN @ Home 1 pt. 6,661
  1. Avatar for Lolzers25 181. Lolzers25 Lv 1 1 pt. 7,197
  2. Avatar for NotJim99 182. NotJim99 Lv 1 1 pt. 7,193
  3. Avatar for christianodonnell 183. christianodonnell Lv 1 1 pt. 7,170
  4. Avatar for pandabearsecond 184. pandabearsecond Lv 1 1 pt. 7,167
  5. Avatar for IHGreenman 185. IHGreenman Lv 1 1 pt. 7,147
  6. Avatar for Thebatman012 186. Thebatman012 Lv 1 1 pt. 7,144
  7. Avatar for emdee314 187. emdee314 Lv 1 1 pt. 7,120
  8. Avatar for mr.Dir 188. mr.Dir Lv 1 1 pt. 7,104
  9. Avatar for momadoc 189. momadoc Lv 1 1 pt. 7,094
  10. Avatar for zeropourcent 190. zeropourcent Lv 1 1 pt. 7,088

Comments