Placeholder image of a protein
Icon representing a puzzle

1124: Revisiting Puzzle 86: Nematode

Closed since over 10 years ago

Intermediate Intermediate Overall Overall Prediction Prediction

Summary

Created
August 11, 2015
Expires
Max points
100
Description

This is a throwback puzzle to the early days of Foldit. This protein, isolated from the hookworm A. caninum, is an extremely potent anticoagulant. This protein contains ten cysteine residues that oxidize to form five disulfide bonds. We are revisiting old Foldit puzzles so we can see how useful the recent additions to the game have been.



Sequence:

KATMQCGENEKYDSCGSKECDKKCKYDGVEEEDDEEPNVPCLVRVCHQDCVCEEGFYRNKDDKCVSAEDCELDNMDFIYPGTRNP

Top groups

  1. Avatar for xkcd 11. xkcd 3 pts. 9,103
  2. Avatar for Natural Abilities 12. Natural Abilities 2 pts. 9,085
  3. Avatar for Italiani Al Lavoro 13. Italiani Al Lavoro 1 pt. 8,922
  4. Avatar for FoldIt@Netherlands 14. FoldIt@Netherlands 1 pt. 8,253
  5. Avatar for BOINC@Poland 15. BOINC@Poland 1 pt. 8,250
  6. Avatar for freefolder 16. freefolder 1 pt. 8,235
  7. Avatar for Eὕρηκα! Heureka! 17. Eὕρηκα! Heureka! 1 pt. 7,400
  8. Avatar for ROMANIA Team 18. ROMANIA Team 1 pt. 7,368
  9. Avatar for CureCoin 19. CureCoin 1 pt. 6,771
  10. Avatar for DSN @ Home 20. DSN @ Home 1 pt. 6,661
  1. Avatar for DingDangDong 191. DingDangDong Lv 1 1 pt. 7,076
  2. Avatar for may of rose 192. may of rose Lv 1 1 pt. 7,025
  3. Avatar for FishKAA 193. FishKAA Lv 1 1 pt. 6,962
  4. Avatar for franse 194. franse Lv 1 1 pt. 6,955
  5. Avatar for ruiabg 195. ruiabg Lv 1 1 pt. 6,930
  6. Avatar for Altercomp 196. Altercomp Lv 1 1 pt. 6,925
  7. Avatar for Tac1 197. Tac1 Lv 1 1 pt. 6,911
  8. Avatar for maskboy 198. maskboy Lv 1 1 pt. 6,901
  9. Avatar for monoleuno2015 199. monoleuno2015 Lv 1 1 pt. 6,876
  10. Avatar for JBMKFM 200. JBMKFM Lv 1 1 pt. 6,809

Comments