Placeholder image of a protein
Icon representing a puzzle

1124: Revisiting Puzzle 86: Nematode

Closed since over 10 years ago

Intermediate Overall Prediction

Summary

Created
August 11, 2015
Expires
Max points
100
Description

This is a throwback puzzle to the early days of Foldit. This protein, isolated from the hookworm A. caninum, is an extremely potent anticoagulant. This protein contains ten cysteine residues that oxidize to form five disulfide bonds. We are revisiting old Foldit puzzles so we can see how useful the recent additions to the game have been.



Sequence:

KATMQCGENEKYDSCGSKECDKKCKYDGVEEEDDEEPNVPCLVRVCHQDCVCEEGFYRNKDDKCVSAEDCELDNMDFIYPGTRNP

Top groups

  1. Avatar for xkcd 11. xkcd 3 pts. 9,103
  2. Avatar for Natural Abilities 12. Natural Abilities 2 pts. 9,085
  3. Avatar for Italiani Al Lavoro 13. Italiani Al Lavoro 1 pt. 8,922
  4. Avatar for FoldIt@Netherlands 14. FoldIt@Netherlands 1 pt. 8,253
  5. Avatar for BOINC@Poland 15. BOINC@Poland 1 pt. 8,250
  6. Avatar for freefolder 16. freefolder 1 pt. 8,235
  7. Avatar for Eὕρηκα! Heureka! 17. Eὕρηκα! Heureka! 1 pt. 7,400
  8. Avatar for ROMANIA Team 18. ROMANIA Team 1 pt. 7,368
  9. Avatar for CureCoin 19. CureCoin 1 pt. 6,771
  10. Avatar for DSN @ Home 20. DSN @ Home 1 pt. 6,661
  1. Avatar for Susume 221. Susume Lv 1 1 pt. 6,073
  2. Avatar for daram1012 222. daram1012 Lv 1 1 pt. 5,848
  3. Avatar for Barraroo 223. Barraroo Lv 1 1 pt. 5,687
  4. Avatar for zkm 224. zkm Lv 1 1 pt. 5,470
  5. Avatar for Primus_Pilus 225. Primus_Pilus Lv 1 1 pt. 5,335
  6. Avatar for vredda 226. vredda Lv 1 1 pt. 5,148
  7. Avatar for ShadowWoobrine 227. ShadowWoobrine Lv 1 1 pt. 4,400
  8. Avatar for Deleted player 228. Deleted player pts. 4,266
  9. Avatar for Hunter266 229. Hunter266 Lv 1 1 pt. 4,182
  10. Avatar for bkoep 230. bkoep Lv 1 1 pt. 4,180

Comments