Placeholder image of a protein
Icon representing a puzzle

1124: Revisiting Puzzle 86: Nematode

Closed since over 10 years ago

Intermediate Overall Prediction

Summary

Created
August 11, 2015
Expires
Max points
100
Description

This is a throwback puzzle to the early days of Foldit. This protein, isolated from the hookworm A. caninum, is an extremely potent anticoagulant. This protein contains ten cysteine residues that oxidize to form five disulfide bonds. We are revisiting old Foldit puzzles so we can see how useful the recent additions to the game have been.



Sequence:

KATMQCGENEKYDSCGSKECDKKCKYDGVEEEDDEEPNVPCLVRVCHQDCVCEEGFYRNKDDKCVSAEDCELDNMDFIYPGTRNP

Top groups

  1. Avatar for xkcd 11. xkcd 3 pts. 9,103
  2. Avatar for Natural Abilities 12. Natural Abilities 2 pts. 9,085
  3. Avatar for Italiani Al Lavoro 13. Italiani Al Lavoro 1 pt. 8,922
  4. Avatar for FoldIt@Netherlands 14. FoldIt@Netherlands 1 pt. 8,253
  5. Avatar for BOINC@Poland 15. BOINC@Poland 1 pt. 8,250
  6. Avatar for freefolder 16. freefolder 1 pt. 8,235
  7. Avatar for Eὕρηκα! Heureka! 17. Eὕρηκα! Heureka! 1 pt. 7,400
  8. Avatar for ROMANIA Team 18. ROMANIA Team 1 pt. 7,368
  9. Avatar for CureCoin 19. CureCoin 1 pt. 6,771
  10. Avatar for DSN @ Home 20. DSN @ Home 1 pt. 6,661
  1. Avatar for JockoTM 231. JockoTM Lv 1 1 pt. 4,180
  2. Avatar for agnairt 232. agnairt Lv 1 1 pt. 4,180
  3. Avatar for hyufds 233. hyufds Lv 1 1 pt. 4,180
  4. Avatar for dflear 234. dflear Lv 1 1 pt. 4,180
  5. Avatar for nwlzephyr 235. nwlzephyr Lv 1 1 pt. 4,180
  6. Avatar for bkoep 236. bkoep Lv 1 1 pt. 4,180
  7. Avatar for DodoBird 237. DodoBird Lv 1 1 pt. 4,180
  8. Avatar for anast 238. anast Lv 1 1 pt. 4,180
  9. Avatar for spvincent 239. spvincent Lv 1 1 pt. 4,180
  10. Avatar for packer 240. packer Lv 1 1 pt. 4,180

Comments