Placeholder image of a protein
Icon representing a puzzle

1124: Revisiting Puzzle 86: Nematode

Closed since over 10 years ago

Intermediate Overall Prediction

Summary

Created
August 11, 2015
Expires
Max points
100
Description

This is a throwback puzzle to the early days of Foldit. This protein, isolated from the hookworm A. caninum, is an extremely potent anticoagulant. This protein contains ten cysteine residues that oxidize to form five disulfide bonds. We are revisiting old Foldit puzzles so we can see how useful the recent additions to the game have been.



Sequence:

KATMQCGENEKYDSCGSKECDKKCKYDGVEEEDDEEPNVPCLVRVCHQDCVCEEGFYRNKDDKCVSAEDCELDNMDFIYPGTRNP

Top groups

  1. Avatar for xkcd 11. xkcd 3 pts. 9,103
  2. Avatar for Natural Abilities 12. Natural Abilities 2 pts. 9,085
  3. Avatar for Italiani Al Lavoro 13. Italiani Al Lavoro 1 pt. 8,922
  4. Avatar for FoldIt@Netherlands 14. FoldIt@Netherlands 1 pt. 8,253
  5. Avatar for BOINC@Poland 15. BOINC@Poland 1 pt. 8,250
  6. Avatar for freefolder 16. freefolder 1 pt. 8,235
  7. Avatar for Eὕρηκα! Heureka! 17. Eὕρηκα! Heureka! 1 pt. 7,400
  8. Avatar for ROMANIA Team 18. ROMANIA Team 1 pt. 7,368
  9. Avatar for CureCoin 19. CureCoin 1 pt. 6,771
  10. Avatar for DSN @ Home 20. DSN @ Home 1 pt. 6,661
  1. Avatar for hpaege 21. hpaege Lv 1 65 pts. 9,675
  2. Avatar for Paulo Roque 22. Paulo Roque Lv 1 64 pts. 9,667
  3. Avatar for nemo7731 23. nemo7731 Lv 1 62 pts. 9,643
  4. Avatar for gitwut 24. gitwut Lv 1 61 pts. 9,638
  5. Avatar for gloverd 25. gloverd Lv 1 59 pts. 9,627
  6. Avatar for jermainiac 26. jermainiac Lv 1 58 pts. 9,610
  7. Avatar for nicobul 27. nicobul Lv 1 57 pts. 9,606
  8. Avatar for smilingone 28. smilingone Lv 1 55 pts. 9,598
  9. Avatar for petetrig 29. petetrig Lv 1 54 pts. 9,596
  10. Avatar for g_b 30. g_b Lv 1 53 pts. 9,594

Comments