Placeholder image of a protein
Icon representing a puzzle

1124: Revisiting Puzzle 86: Nematode

Closed since over 10 years ago

Intermediate Overall Prediction

Summary

Created
August 11, 2015
Expires
Max points
100
Description

This is a throwback puzzle to the early days of Foldit. This protein, isolated from the hookworm A. caninum, is an extremely potent anticoagulant. This protein contains ten cysteine residues that oxidize to form five disulfide bonds. We are revisiting old Foldit puzzles so we can see how useful the recent additions to the game have been.



Sequence:

KATMQCGENEKYDSCGSKECDKKCKYDGVEEEDDEEPNVPCLVRVCHQDCVCEEGFYRNKDDKCVSAEDCELDNMDFIYPGTRNP

Top groups

  1. Avatar for xkcd 11. xkcd 3 pts. 9,103
  2. Avatar for Natural Abilities 12. Natural Abilities 2 pts. 9,085
  3. Avatar for Italiani Al Lavoro 13. Italiani Al Lavoro 1 pt. 8,922
  4. Avatar for FoldIt@Netherlands 14. FoldIt@Netherlands 1 pt. 8,253
  5. Avatar for BOINC@Poland 15. BOINC@Poland 1 pt. 8,250
  6. Avatar for freefolder 16. freefolder 1 pt. 8,235
  7. Avatar for Eὕρηκα! Heureka! 17. Eὕρηκα! Heureka! 1 pt. 7,400
  8. Avatar for ROMANIA Team 18. ROMANIA Team 1 pt. 7,368
  9. Avatar for CureCoin 19. CureCoin 1 pt. 6,771
  10. Avatar for DSN @ Home 20. DSN @ Home 1 pt. 6,661
  1. Avatar for lilovip 81. lilovip Lv 1 14 pts. 8,879
  2. Avatar for Mohambone 82. Mohambone Lv 1 13 pts. 8,858
  3. Avatar for ecali 83. ecali Lv 1 13 pts. 8,809
  4. Avatar for Festering Wounds 84. Festering Wounds Lv 1 12 pts. 8,801
  5. Avatar for Terafold 85. Terafold Lv 1 12 pts. 8,793
  6. Avatar for MaartenDesnouck 86. MaartenDesnouck Lv 1 12 pts. 8,787
  7. Avatar for PrettyPony2001 87. PrettyPony2001 Lv 1 11 pts. 8,714
  8. Avatar for Soggy Doglog 88. Soggy Doglog Lv 1 11 pts. 8,710
  9. Avatar for greepski 89. greepski Lv 1 11 pts. 8,705
  10. Avatar for smholst 90. smholst Lv 1 10 pts. 8,704

Comments