Placeholder image of a protein
Icon representing a puzzle

1124: Revisiting Puzzle 86: Nematode

Closed since almost 11 years ago

Intermediate Intermediate Intermediate Intermediate Intermediate Intermediate Intermediate Intermediate Intermediate Intermediate Overall Overall Overall Overall Overall Overall Overall Overall Overall Overall Prediction Prediction Prediction Prediction Prediction Prediction Prediction Prediction Prediction Prediction

Summary


Created
August 11, 2015
Expires
Max points
100
Description

This is a throwback puzzle to the early days of Foldit. This protein, isolated from the hookworm A. caninum, is an extremely potent anticoagulant. This protein contains ten cysteine residues that oxidize to form five disulfide bonds. We are revisiting old Foldit puzzles so we can see how useful the recent additions to the game have been.



Sequence:

KATMQCGENEKYDSCGSKECDKKCKYDGVEEEDDEEPNVPCLVRVCHQDCVCEEGFYRNKDDKCVSAEDCELDNMDFIYPGTRNP

Top groups


  1. Avatar for Go Science 100 pts. 10,031
  2. Avatar for Gargleblasters 2. Gargleblasters 77 pts. 9,983
  3. Avatar for Beta Folders 3. Beta Folders 58 pts. 9,919
  4. Avatar for Anthropic Dreams 4. Anthropic Dreams 43 pts. 9,918
  5. Avatar for Contenders 5. Contenders 31 pts. 9,884
  6. Avatar for Deleted group 6. Deleted group pts. 9,693
  7. Avatar for L'Alliance Francophone 7. L'Alliance Francophone 15 pts. 9,606
  8. Avatar for Void Crushers 8. Void Crushers 11 pts. 9,584
  9. Avatar for HMT heritage 9. HMT heritage 7 pts. 9,547
  10. Avatar for Deleted group 10. Deleted group pts. 9,283

  1. Avatar for pauldunn 11. pauldunn Lv 1 26 pts. 9,955
  2. Avatar for dbuske 12. dbuske Lv 1 22 pts. 9,945
  3. Avatar for frood66 13. frood66 Lv 1 19 pts. 9,931
  4. Avatar for LociOiling 14. LociOiling Lv 1 16 pts. 9,919
  5. Avatar for phi16 15. phi16 Lv 1 14 pts. 9,918
  6. Avatar for ManVsYard 16. ManVsYard Lv 1 11 pts. 9,914
  7. Avatar for AryehK 17. AryehK Lv 1 10 pts. 9,909
  8. Avatar for Galaxie 18. Galaxie Lv 1 8 pts. 9,906
  9. Avatar for smilingone 19. smilingone Lv 1 7 pts. 9,905
  10. Avatar for MaartenDesnouck 20. MaartenDesnouck Lv 1 5 pts. 9,904

Comments