Placeholder image of a protein
Icon representing a puzzle

1124: Revisiting Puzzle 86: Nematode

Closed since over 10 years ago

Intermediate Overall Prediction

Summary

Created
August 11, 2015
Expires
Max points
100
Description

This is a throwback puzzle to the early days of Foldit. This protein, isolated from the hookworm A. caninum, is an extremely potent anticoagulant. This protein contains ten cysteine residues that oxidize to form five disulfide bonds. We are revisiting old Foldit puzzles so we can see how useful the recent additions to the game have been.



Sequence:

KATMQCGENEKYDSCGSKECDKKCKYDGVEEEDDEEPNVPCLVRVCHQDCVCEEGFYRNKDDKCVSAEDCELDNMDFIYPGTRNP

Top groups

  1. Avatar for Go Science
    1. Go Science
    100 pts. 10,031
  2. Avatar for Gargleblasters 2. Gargleblasters 77 pts. 9,983
  3. Avatar for Beta Folders 3. Beta Folders 58 pts. 9,919
  4. Avatar for Anthropic Dreams 4. Anthropic Dreams 43 pts. 9,918
  5. Avatar for Contenders 5. Contenders 31 pts. 9,884
  6. Avatar for Deleted group 6. Deleted group pts. 9,693
  7. Avatar for L'Alliance Francophone 7. L'Alliance Francophone 15 pts. 9,606
  8. Avatar for Void Crushers 8. Void Crushers 11 pts. 9,584
  9. Avatar for HMT heritage 9. HMT heritage 7 pts. 9,547
  10. Avatar for Deleted group 10. Deleted group pts. 9,283
  1. Avatar for inkycatz 111. inkycatz Lv 1 5 pts. 8,288
  2. Avatar for ViJay7019 112. ViJay7019 Lv 1 5 pts. 8,253
  3. Avatar for kitek314_pl 113. kitek314_pl Lv 1 5 pts. 8,250
  4. Avatar for Imeturoran 114. Imeturoran Lv 1 5 pts. 8,235
  5. Avatar for Iron pet 115. Iron pet Lv 1 4 pts. 8,202
  6. Avatar for Jajaboman 116. Jajaboman Lv 1 4 pts. 8,198
  7. Avatar for bamh 117. bamh Lv 1 4 pts. 8,185
  8. Avatar for lange 118. lange Lv 1 4 pts. 8,181
  9. Avatar for Tweedle Dumb 119. Tweedle Dumb Lv 1 4 pts. 8,180
  10. Avatar for harvardman 120. harvardman Lv 1 4 pts. 8,162

Comments