Placeholder image of a protein
Icon representing a puzzle

1124: Revisiting Puzzle 86: Nematode

Closed since over 10 years ago

Intermediate Overall Prediction

Summary

Created
August 11, 2015
Expires
Max points
100
Description

This is a throwback puzzle to the early days of Foldit. This protein, isolated from the hookworm A. caninum, is an extremely potent anticoagulant. This protein contains ten cysteine residues that oxidize to form five disulfide bonds. We are revisiting old Foldit puzzles so we can see how useful the recent additions to the game have been.



Sequence:

KATMQCGENEKYDSCGSKECDKKCKYDGVEEEDDEEPNVPCLVRVCHQDCVCEEGFYRNKDDKCVSAEDCELDNMDFIYPGTRNP

Top groups

  1. Avatar for Go Science
    1. Go Science
    100 pts. 10,031
  2. Avatar for Gargleblasters 2. Gargleblasters 77 pts. 9,983
  3. Avatar for Beta Folders 3. Beta Folders 58 pts. 9,919
  4. Avatar for Anthropic Dreams 4. Anthropic Dreams 43 pts. 9,918
  5. Avatar for Contenders 5. Contenders 31 pts. 9,884
  6. Avatar for Deleted group 6. Deleted group pts. 9,693
  7. Avatar for L'Alliance Francophone 7. L'Alliance Francophone 15 pts. 9,606
  8. Avatar for Void Crushers 8. Void Crushers 11 pts. 9,584
  9. Avatar for HMT heritage 9. HMT heritage 7 pts. 9,547
  10. Avatar for Deleted group 10. Deleted group pts. 9,283
  1. Avatar for andrewxc 71. andrewxc Lv 1 18 pts. 9,035
  2. Avatar for alwen 72. alwen Lv 1 18 pts. 9,026
  3. Avatar for pfirth 73. pfirth Lv 1 17 pts. 8,968
  4. Avatar for ManVsYard 74. ManVsYard Lv 1 17 pts. 8,943
  5. Avatar for Satina 75. Satina Lv 1 16 pts. 8,937
  6. Avatar for deLaCeiba 76. deLaCeiba Lv 1 16 pts. 8,922
  7. Avatar for RockOn 77. RockOn Lv 1 15 pts. 8,921
  8. Avatar for molleke 78. molleke Lv 1 15 pts. 8,912
  9. Avatar for Mydogisa Toelicker 79. Mydogisa Toelicker Lv 1 14 pts. 8,901
  10. Avatar for NameChangeNeeded01 80. NameChangeNeeded01 Lv 1 14 pts. 8,898

Comments