Placeholder image of a protein
Icon representing a puzzle

1126: De-novo Freestyle 55

Closed since over 10 years ago

Intermediate Overall Prediction

Summary

Created
August 14, 2015
Expires
Max points
100
Description

Little is known about this protein, which was identified in the genome of D. piger. The PSIPRED secondary structure predictions are provided on the starting model.



Sequence:

WDGFDADSADLVEIIPDALPNKGDTVDVRNYSNDETTTCLVVSVTRNSRTVEIVVRTPDGEAHTLVMEGR

Top groups

  1. Avatar for Italiani Al Lavoro 11. Italiani Al Lavoro 3 pts. 8,424
  2. Avatar for Deleted group 12. Deleted group pts. 8,321
  3. Avatar for SETI.Germany 13. SETI.Germany 1 pt. 8,264
  4. Avatar for freefolder 14. freefolder 1 pt. 8,222
  5. Avatar for BOINC@Poland 15. BOINC@Poland 1 pt. 8,123
  6. Avatar for xkcd 16. xkcd 1 pt. 8,106
  7. Avatar for Natural Abilities 17. Natural Abilities 1 pt. 7,693
  8. Avatar for CureCoin 18. CureCoin 1 pt. 5,442
  9. Avatar for DSN @ Home 19. DSN @ Home 1 pt. 4,101
  10. Avatar for DCC Folders 20. DCC Folders 1 pt. 0
  1. Avatar for pizpot 101. pizpot Lv 1 6 pts. 7,947
  2. Avatar for tallguy-13088 102. tallguy-13088 Lv 1 6 pts. 7,946
  3. Avatar for karost 103. karost Lv 1 6 pts. 7,935
  4. Avatar for Udjine 104. Udjine Lv 1 5 pts. 7,930
  5. Avatar for dbuske 105. dbuske Lv 1 5 pts. 7,911
  6. Avatar for manu8170 106. manu8170 Lv 1 5 pts. 7,910
  7. Avatar for polly66017 107. polly66017 Lv 1 5 pts. 7,906
  8. Avatar for demeter900 108. demeter900 Lv 1 5 pts. 7,906
  9. Avatar for guineapig 109. guineapig Lv 1 5 pts. 7,888
  10. Avatar for Kelly Barnett 110. Kelly Barnett Lv 1 4 pts. 7,887

Comments

bkoep Staff Lv 1

Unfortunately, we only know of a few proteins that are homologous to this one. We need a large number of homologous sequences for covariance analysis, which is how we typically predict residue-residue contacts.