Placeholder image of a protein
Icon representing a puzzle

1126: De-novo Freestyle 55

Closed since over 10 years ago

Intermediate Overall Prediction

Summary

Created
August 14, 2015
Expires
Max points
100
Description

Little is known about this protein, which was identified in the genome of D. piger. The PSIPRED secondary structure predictions are provided on the starting model.



Sequence:

WDGFDADSADLVEIIPDALPNKGDTVDVRNYSNDETTTCLVVSVTRNSRTVEIVVRTPDGEAHTLVMEGR

Top groups

  1. Avatar for Contenders
    1. Contenders
    100 pts. 8,864
  2. Avatar for Go Science 2. Go Science 77 pts. 8,816
  3. Avatar for Anthropic Dreams 3. Anthropic Dreams 58 pts. 8,811
  4. Avatar for Beta Folders 4. Beta Folders 43 pts. 8,725
  5. Avatar for Gargleblasters 5. Gargleblasters 31 pts. 8,694
  6. Avatar for Void Crushers 6. Void Crushers 22 pts. 8,623
  7. Avatar for L'Alliance Francophone 7. L'Alliance Francophone 15 pts. 8,601
  8. Avatar for Deleted group 8. Deleted group pts. 8,497
  9. Avatar for HMT heritage 9. HMT heritage 7 pts. 8,485
  10. Avatar for FoldIt@Netherlands 10. FoldIt@Netherlands 5 pts. 8,471
  1. Avatar for pizpot 101. pizpot Lv 1 6 pts. 7,947
  2. Avatar for tallguy-13088 102. tallguy-13088 Lv 1 6 pts. 7,946
  3. Avatar for karost 103. karost Lv 1 6 pts. 7,935
  4. Avatar for Udjine 104. Udjine Lv 1 5 pts. 7,930
  5. Avatar for dbuske 105. dbuske Lv 1 5 pts. 7,911
  6. Avatar for manu8170 106. manu8170 Lv 1 5 pts. 7,910
  7. Avatar for polly66017 107. polly66017 Lv 1 5 pts. 7,906
  8. Avatar for demeter900 108. demeter900 Lv 1 5 pts. 7,906
  9. Avatar for guineapig 109. guineapig Lv 1 5 pts. 7,888
  10. Avatar for Kelly Barnett 110. Kelly Barnett Lv 1 4 pts. 7,887

Comments

bkoep Staff Lv 1

Unfortunately, we only know of a few proteins that are homologous to this one. We need a large number of homologous sequences for covariance analysis, which is how we typically predict residue-residue contacts.