Placeholder image of a protein
Icon representing a puzzle

1126: De-novo Freestyle 55

Closed since over 10 years ago

Intermediate Overall Prediction

Summary

Created
August 14, 2015
Expires
Max points
100
Description

Little is known about this protein, which was identified in the genome of D. piger. The PSIPRED secondary structure predictions are provided on the starting model.



Sequence:

WDGFDADSADLVEIIPDALPNKGDTVDVRNYSNDETTTCLVVSVTRNSRTVEIVVRTPDGEAHTLVMEGR

Top groups

  1. Avatar for Italiani Al Lavoro 11. Italiani Al Lavoro 3 pts. 8,424
  2. Avatar for Deleted group 12. Deleted group pts. 8,321
  3. Avatar for SETI.Germany 13. SETI.Germany 1 pt. 8,264
  4. Avatar for freefolder 14. freefolder 1 pt. 8,222
  5. Avatar for BOINC@Poland 15. BOINC@Poland 1 pt. 8,123
  6. Avatar for xkcd 16. xkcd 1 pt. 8,106
  7. Avatar for Natural Abilities 17. Natural Abilities 1 pt. 7,693
  8. Avatar for CureCoin 18. CureCoin 1 pt. 5,442
  9. Avatar for DSN @ Home 19. DSN @ Home 1 pt. 4,101
  10. Avatar for DCC Folders 20. DCC Folders 1 pt. 0
  1. Avatar for 01010011111 121. 01010011111 Lv 1 3 pts. 7,784
  2. Avatar for Vinara 122. Vinara Lv 1 3 pts. 7,771
  3. Avatar for jseckler 123. jseckler Lv 1 3 pts. 7,769
  4. Avatar for ViJay7019 124. ViJay7019 Lv 1 3 pts. 7,758
  5. Avatar for lange 125. lange Lv 1 2 pts. 7,756
  6. Avatar for ecali 126. ecali Lv 1 2 pts. 7,743
  7. Avatar for jebbiek 127. jebbiek Lv 1 2 pts. 7,742
  8. Avatar for proteansoup 128. proteansoup Lv 1 2 pts. 7,741
  9. Avatar for Mydogisa Toelicker 129. Mydogisa Toelicker Lv 1 2 pts. 7,733
  10. Avatar for Festering Wounds 130. Festering Wounds Lv 1 2 pts. 7,732

Comments

bkoep Staff Lv 1

Unfortunately, we only know of a few proteins that are homologous to this one. We need a large number of homologous sequences for covariance analysis, which is how we typically predict residue-residue contacts.