Placeholder image of a protein
Icon representing a puzzle

1126: De-novo Freestyle 55

Closed since over 10 years ago

Intermediate Overall Prediction

Summary

Created
August 14, 2015
Expires
Max points
100
Description

Little is known about this protein, which was identified in the genome of D. piger. The PSIPRED secondary structure predictions are provided on the starting model.



Sequence:

WDGFDADSADLVEIIPDALPNKGDTVDVRNYSNDETTTCLVVSVTRNSRTVEIVVRTPDGEAHTLVMEGR

Top groups

  1. Avatar for Contenders
    1. Contenders
    100 pts. 8,864
  2. Avatar for Go Science 2. Go Science 77 pts. 8,816
  3. Avatar for Anthropic Dreams 3. Anthropic Dreams 58 pts. 8,811
  4. Avatar for Beta Folders 4. Beta Folders 43 pts. 8,725
  5. Avatar for Gargleblasters 5. Gargleblasters 31 pts. 8,694
  6. Avatar for Void Crushers 6. Void Crushers 22 pts. 8,623
  7. Avatar for L'Alliance Francophone 7. L'Alliance Francophone 15 pts. 8,601
  8. Avatar for Deleted group 8. Deleted group pts. 8,497
  9. Avatar for HMT heritage 9. HMT heritage 7 pts. 8,485
  10. Avatar for FoldIt@Netherlands 10. FoldIt@Netherlands 5 pts. 8,471
  1. Avatar for 01010011111 121. 01010011111 Lv 1 3 pts. 7,784
  2. Avatar for Vinara 122. Vinara Lv 1 3 pts. 7,771
  3. Avatar for jseckler 123. jseckler Lv 1 3 pts. 7,769
  4. Avatar for ViJay7019 124. ViJay7019 Lv 1 3 pts. 7,758
  5. Avatar for lange 125. lange Lv 1 2 pts. 7,756
  6. Avatar for ecali 126. ecali Lv 1 2 pts. 7,743
  7. Avatar for jebbiek 127. jebbiek Lv 1 2 pts. 7,742
  8. Avatar for proteansoup 128. proteansoup Lv 1 2 pts. 7,741
  9. Avatar for Mydogisa Toelicker 129. Mydogisa Toelicker Lv 1 2 pts. 7,733
  10. Avatar for Festering Wounds 130. Festering Wounds Lv 1 2 pts. 7,732

Comments

bkoep Staff Lv 1

Unfortunately, we only know of a few proteins that are homologous to this one. We need a large number of homologous sequences for covariance analysis, which is how we typically predict residue-residue contacts.