Placeholder image of a protein
Icon representing a puzzle

1126: De-novo Freestyle 55

Closed since over 10 years ago

Intermediate Overall Prediction

Summary

Created
August 14, 2015
Expires
Max points
100
Description

Little is known about this protein, which was identified in the genome of D. piger. The PSIPRED secondary structure predictions are provided on the starting model.



Sequence:

WDGFDADSADLVEIIPDALPNKGDTVDVRNYSNDETTTCLVVSVTRNSRTVEIVVRTPDGEAHTLVMEGR

Top groups

  1. Avatar for Italiani Al Lavoro 11. Italiani Al Lavoro 3 pts. 8,424
  2. Avatar for Deleted group 12. Deleted group pts. 8,321
  3. Avatar for SETI.Germany 13. SETI.Germany 1 pt. 8,264
  4. Avatar for freefolder 14. freefolder 1 pt. 8,222
  5. Avatar for BOINC@Poland 15. BOINC@Poland 1 pt. 8,123
  6. Avatar for xkcd 16. xkcd 1 pt. 8,106
  7. Avatar for Natural Abilities 17. Natural Abilities 1 pt. 7,693
  8. Avatar for CureCoin 18. CureCoin 1 pt. 5,442
  9. Avatar for DSN @ Home 19. DSN @ Home 1 pt. 4,101
  10. Avatar for DCC Folders 20. DCC Folders 1 pt. 0
  1. Avatar for Ernst Zundel 131. Ernst Zundel Lv 1 2 pts. 7,716
  2. Avatar for TJOK fan 132. TJOK fan Lv 1 2 pts. 7,714
  3. Avatar for PrettyPony2001 133. PrettyPony2001 Lv 1 2 pts. 7,701
  4. Avatar for Colostomy EXPLOSION. 134. Colostomy EXPLOSION. Lv 1 2 pts. 7,701
  5. Avatar for Inkedhands 135. Inkedhands Lv 1 2 pts. 7,699
  6. Avatar for Mr_Jolty 136. Mr_Jolty Lv 1 2 pts. 7,693
  7. Avatar for poiuyqwert 137. poiuyqwert Lv 1 2 pts. 7,692
  8. Avatar for NameChangeNeeded01 138. NameChangeNeeded01 Lv 1 2 pts. 7,688
  9. Avatar for Mohambone 139. Mohambone Lv 1 1 pt. 7,681
  10. Avatar for Pro Lapser 140. Pro Lapser Lv 1 1 pt. 7,678

Comments

bkoep Staff Lv 1

Unfortunately, we only know of a few proteins that are homologous to this one. We need a large number of homologous sequences for covariance analysis, which is how we typically predict residue-residue contacts.