Placeholder image of a protein
Icon representing a puzzle

1126: De-novo Freestyle 55

Closed since over 10 years ago

Intermediate Overall Prediction

Summary

Created
August 14, 2015
Expires
Max points
100
Description

Little is known about this protein, which was identified in the genome of D. piger. The PSIPRED secondary structure predictions are provided on the starting model.



Sequence:

WDGFDADSADLVEIIPDALPNKGDTVDVRNYSNDETTTCLVVSVTRNSRTVEIVVRTPDGEAHTLVMEGR

Top groups

  1. Avatar for Contenders
    1. Contenders
    100 pts. 8,864
  2. Avatar for Go Science 2. Go Science 77 pts. 8,816
  3. Avatar for Anthropic Dreams 3. Anthropic Dreams 58 pts. 8,811
  4. Avatar for Beta Folders 4. Beta Folders 43 pts. 8,725
  5. Avatar for Gargleblasters 5. Gargleblasters 31 pts. 8,694
  6. Avatar for Void Crushers 6. Void Crushers 22 pts. 8,623
  7. Avatar for L'Alliance Francophone 7. L'Alliance Francophone 15 pts. 8,601
  8. Avatar for Deleted group 8. Deleted group pts. 8,497
  9. Avatar for HMT heritage 9. HMT heritage 7 pts. 8,485
  10. Avatar for FoldIt@Netherlands 10. FoldIt@Netherlands 5 pts. 8,471
  1. Avatar for Ernst Zundel 131. Ernst Zundel Lv 1 2 pts. 7,716
  2. Avatar for TJOK fan 132. TJOK fan Lv 1 2 pts. 7,714
  3. Avatar for PrettyPony2001 133. PrettyPony2001 Lv 1 2 pts. 7,701
  4. Avatar for Colostomy EXPLOSION. 134. Colostomy EXPLOSION. Lv 1 2 pts. 7,701
  5. Avatar for Inkedhands 135. Inkedhands Lv 1 2 pts. 7,699
  6. Avatar for Mr_Jolty 136. Mr_Jolty Lv 1 2 pts. 7,693
  7. Avatar for poiuyqwert 137. poiuyqwert Lv 1 2 pts. 7,692
  8. Avatar for NameChangeNeeded01 138. NameChangeNeeded01 Lv 1 2 pts. 7,688
  9. Avatar for Mohambone 139. Mohambone Lv 1 1 pt. 7,681
  10. Avatar for Pro Lapser 140. Pro Lapser Lv 1 1 pt. 7,678

Comments

bkoep Staff Lv 1

Unfortunately, we only know of a few proteins that are homologous to this one. We need a large number of homologous sequences for covariance analysis, which is how we typically predict residue-residue contacts.