Placeholder image of a protein
Icon representing a puzzle

1126: De-novo Freestyle 55

Closed since over 10 years ago

Intermediate Overall Prediction

Summary

Created
August 14, 2015
Expires
Max points
100
Description

Little is known about this protein, which was identified in the genome of D. piger. The PSIPRED secondary structure predictions are provided on the starting model.



Sequence:

WDGFDADSADLVEIIPDALPNKGDTVDVRNYSNDETTTCLVVSVTRNSRTVEIVVRTPDGEAHTLVMEGR

Top groups

  1. Avatar for Italiani Al Lavoro 11. Italiani Al Lavoro 3 pts. 8,424
  2. Avatar for Deleted group 12. Deleted group pts. 8,321
  3. Avatar for SETI.Germany 13. SETI.Germany 1 pt. 8,264
  4. Avatar for freefolder 14. freefolder 1 pt. 8,222
  5. Avatar for BOINC@Poland 15. BOINC@Poland 1 pt. 8,123
  6. Avatar for xkcd 16. xkcd 1 pt. 8,106
  7. Avatar for Natural Abilities 17. Natural Abilities 1 pt. 7,693
  8. Avatar for CureCoin 18. CureCoin 1 pt. 5,442
  9. Avatar for DSN @ Home 19. DSN @ Home 1 pt. 4,101
  10. Avatar for DCC Folders 20. DCC Folders 1 pt. 0
  1. Avatar for egran48 51. egran48 Lv 1 30 pts. 8,419
  2. Avatar for joremen 52. joremen Lv 1 29 pts. 8,412
  3. Avatar for martin.szew 53. martin.szew Lv 1 28 pts. 8,391
  4. Avatar for Mike Cassidy 54. Mike Cassidy Lv 1 27 pts. 8,390
  5. Avatar for Glen B 55. Glen B Lv 1 26 pts. 8,380
  6. Avatar for dettingen 56. dettingen Lv 1 26 pts. 8,379
  7. Avatar for jobo0502 57. jobo0502 Lv 1 25 pts. 8,374
  8. Avatar for Anfinsen_slept_here 58. Anfinsen_slept_here Lv 1 24 pts. 8,372
  9. Avatar for YeshuaLives 59. YeshuaLives Lv 1 24 pts. 8,365
  10. Avatar for phi16 60. phi16 Lv 1 23 pts. 8,351

Comments

bkoep Staff Lv 1

Unfortunately, we only know of a few proteins that are homologous to this one. We need a large number of homologous sequences for covariance analysis, which is how we typically predict residue-residue contacts.