Placeholder image of a protein
Icon representing a puzzle

1126: De-novo Freestyle 55

Closed since over 10 years ago

Intermediate Overall Prediction

Summary

Created
August 14, 2015
Expires
Max points
100
Description

Little is known about this protein, which was identified in the genome of D. piger. The PSIPRED secondary structure predictions are provided on the starting model.



Sequence:

WDGFDADSADLVEIIPDALPNKGDTVDVRNYSNDETTTCLVVSVTRNSRTVEIVVRTPDGEAHTLVMEGR

Top groups

  1. Avatar for Contenders
    1. Contenders
    100 pts. 8,864
  2. Avatar for Go Science 2. Go Science 77 pts. 8,816
  3. Avatar for Anthropic Dreams 3. Anthropic Dreams 58 pts. 8,811
  4. Avatar for Beta Folders 4. Beta Folders 43 pts. 8,725
  5. Avatar for Gargleblasters 5. Gargleblasters 31 pts. 8,694
  6. Avatar for Void Crushers 6. Void Crushers 22 pts. 8,623
  7. Avatar for L'Alliance Francophone 7. L'Alliance Francophone 15 pts. 8,601
  8. Avatar for Deleted group 8. Deleted group pts. 8,497
  9. Avatar for HMT heritage 9. HMT heritage 7 pts. 8,485
  10. Avatar for FoldIt@Netherlands 10. FoldIt@Netherlands 5 pts. 8,471
  1. Avatar for egran48 51. egran48 Lv 1 30 pts. 8,419
  2. Avatar for joremen 52. joremen Lv 1 29 pts. 8,412
  3. Avatar for martin.szew 53. martin.szew Lv 1 28 pts. 8,391
  4. Avatar for Mike Cassidy 54. Mike Cassidy Lv 1 27 pts. 8,390
  5. Avatar for Glen B 55. Glen B Lv 1 26 pts. 8,380
  6. Avatar for dettingen 56. dettingen Lv 1 26 pts. 8,379
  7. Avatar for jobo0502 57. jobo0502 Lv 1 25 pts. 8,374
  8. Avatar for Anfinsen_slept_here 58. Anfinsen_slept_here Lv 1 24 pts. 8,372
  9. Avatar for YeshuaLives 59. YeshuaLives Lv 1 24 pts. 8,365
  10. Avatar for phi16 60. phi16 Lv 1 23 pts. 8,351

Comments

bkoep Staff Lv 1

Unfortunately, we only know of a few proteins that are homologous to this one. We need a large number of homologous sequences for covariance analysis, which is how we typically predict residue-residue contacts.