Placeholder image of a protein
Icon representing a puzzle

1126: De-novo Freestyle 55

Closed since over 10 years ago

Intermediate Overall Prediction

Summary

Created
August 14, 2015
Expires
Max points
100
Description

Little is known about this protein, which was identified in the genome of D. piger. The PSIPRED secondary structure predictions are provided on the starting model.



Sequence:

WDGFDADSADLVEIIPDALPNKGDTVDVRNYSNDETTTCLVVSVTRNSRTVEIVVRTPDGEAHTLVMEGR

Top groups

  1. Avatar for Contenders
    1. Contenders
    100 pts. 8,864
  2. Avatar for Go Science 2. Go Science 77 pts. 8,816
  3. Avatar for Anthropic Dreams 3. Anthropic Dreams 58 pts. 8,811
  4. Avatar for Beta Folders 4. Beta Folders 43 pts. 8,725
  5. Avatar for Gargleblasters 5. Gargleblasters 31 pts. 8,694
  6. Avatar for Void Crushers 6. Void Crushers 22 pts. 8,623
  7. Avatar for L'Alliance Francophone 7. L'Alliance Francophone 15 pts. 8,601
  8. Avatar for Deleted group 8. Deleted group pts. 8,497
  9. Avatar for HMT heritage 9. HMT heritage 7 pts. 8,485
  10. Avatar for FoldIt@Netherlands 10. FoldIt@Netherlands 5 pts. 8,471
  1. Avatar for DrOlivia 211. DrOlivia Lv 1 1 pt. 4,154
  2. Avatar for aspadistra 212. aspadistra Lv 1 1 pt. 4,101
  3. Avatar for Kevonni 213. Kevonni Lv 1 1 pt. 3,346
  4. Avatar for bkoep 214. bkoep Lv 1 1 pt. 0
  5. Avatar for Rafael-Areas 215. Rafael-Areas Lv 1 1 pt. 0
  6. Avatar for Abraxas0815 216. Abraxas0815 Lv 1 1 pt. 0
  7. Avatar for spvincent 217. spvincent Lv 1 1 pt. 0
  8. Avatar for greepski 218. greepski Lv 1 1 pt. 0
  9. Avatar for Soggy Doglog 219. Soggy Doglog Lv 1 1 pt. 0
  10. Avatar for jstoddard 220. jstoddard Lv 1 1 pt. 0

Comments

bkoep Staff Lv 1

Unfortunately, we only know of a few proteins that are homologous to this one. We need a large number of homologous sequences for covariance analysis, which is how we typically predict residue-residue contacts.