Placeholder image of a protein
Icon representing a puzzle

1126: De-novo Freestyle 55

Closed since over 10 years ago

Intermediate Overall Prediction

Summary

Created
August 14, 2015
Expires
Max points
100
Description

Little is known about this protein, which was identified in the genome of D. piger. The PSIPRED secondary structure predictions are provided on the starting model.



Sequence:

WDGFDADSADLVEIIPDALPNKGDTVDVRNYSNDETTTCLVVSVTRNSRTVEIVVRTPDGEAHTLVMEGR

Top groups

  1. Avatar for Contenders
    1. Contenders
    100 pts. 8,864
  2. Avatar for Go Science 2. Go Science 77 pts. 8,816
  3. Avatar for Anthropic Dreams 3. Anthropic Dreams 58 pts. 8,811
  4. Avatar for Beta Folders 4. Beta Folders 43 pts. 8,725
  5. Avatar for Gargleblasters 5. Gargleblasters 31 pts. 8,694
  6. Avatar for Void Crushers 6. Void Crushers 22 pts. 8,623
  7. Avatar for L'Alliance Francophone 7. L'Alliance Francophone 15 pts. 8,601
  8. Avatar for Deleted group 8. Deleted group pts. 8,497
  9. Avatar for HMT heritage 9. HMT heritage 7 pts. 8,485
  10. Avatar for FoldIt@Netherlands 10. FoldIt@Netherlands 5 pts. 8,471
  1. Avatar for may of rose 191. may of rose Lv 1 1 pt. 5,699
  2. Avatar for Punktchen 192. Punktchen Lv 1 1 pt. 5,680
  3. Avatar for free_radical 193. free_radical Lv 1 1 pt. 5,627
  4. Avatar for panzerbjorn 194. panzerbjorn Lv 1 1 pt. 5,626
  5. Avatar for calgone 195. calgone Lv 1 1 pt. 5,528
  6. Avatar for AryehK 196. AryehK Lv 1 1 pt. 5,528
  7. Avatar for Lolzers25 197. Lolzers25 Lv 1 1 pt. 5,488
  8. Avatar for Acidic Pink 198. Acidic Pink Lv 1 1 pt. 5,480
  9. Avatar for Dakasleif 199. Dakasleif Lv 1 1 pt. 5,442
  10. Avatar for smarthuman 200. smarthuman Lv 1 1 pt. 5,442

Comments

bkoep Staff Lv 1

Unfortunately, we only know of a few proteins that are homologous to this one. We need a large number of homologous sequences for covariance analysis, which is how we typically predict residue-residue contacts.