1127: Revisiting Puzzle 87: Zinc Binding Protein
Closed since over 10 years ago
Intermediate Overall PredictionSummary
- Created
- August 18, 2015
- Expires
- Max points
- 100
This is a throwback puzzle to the early days of Foldit. This small peptide is part of a larger protein that helps to regulate cell division, and is very important in early embryonic development. The protein is modeled here as in a reduced environment, so no disulfide bonds are expected to form. We are revisiting old Foldit puzzles so we can see how useful the recent additions to the game have been.
Sequence:
EKCSEHDERLKLYCKDDGTLSCVICRDSLKHASHNFLPI
