Placeholder image of a protein
Icon representing a puzzle

1127: Revisiting Puzzle 87: Zinc Binding Protein

Closed since over 10 years ago

Intermediate Intermediate Intermediate Intermediate Intermediate Intermediate Overall Overall Overall Overall Overall Overall Prediction Prediction Prediction Prediction Prediction Prediction

Summary


Created
August 18, 2015
Expires
Max points
100
Description

This is a throwback puzzle to the early days of Foldit. This small peptide is part of a larger protein that helps to regulate cell division, and is very important in early embryonic development. The protein is modeled here as in a reduced environment, so no disulfide bonds are expected to form. We are revisiting old Foldit puzzles so we can see how useful the recent additions to the game have been.



Sequence:

EKCSEHDERLKLYCKDDGTLSCVICRDSLKHASHNFLPI

Top groups


  1. Avatar for Gargleblasters 100 pts. 8,384
  2. Avatar for Anthropic Dreams 2. Anthropic Dreams 80 pts. 8,383
  3. Avatar for Go Science 3. Go Science 63 pts. 8,365
  4. Avatar for Contenders 4. Contenders 49 pts. 8,361
  5. Avatar for HMT heritage 5. HMT heritage 37 pts. 8,361
  6. Avatar for Beta Folders 6. Beta Folders 28 pts. 8,332
  7. Avatar for Deleted group 7. Deleted group pts. 8,325
  8. Avatar for Void Crushers 8. Void Crushers 15 pts. 8,318
  9. Avatar for L'Alliance Francophone 9. L'Alliance Francophone 11 pts. 8,291
  10. Avatar for freefolder 10. freefolder 8 pts. 8,237

  1. Avatar for pauldunn 11. pauldunn Lv 1 81 pts. 8,328
  2. Avatar for Timo van der Laan 12. Timo van der Laan Lv 1 79 pts. 8,318
  3. Avatar for LociOiling 13. LociOiling Lv 1 78 pts. 8,315
  4. Avatar for Vredeman 14. Vredeman Lv 1 76 pts. 8,315
  5. Avatar for Anfinsen_slept_here 15. Anfinsen_slept_here Lv 1 74 pts. 8,308
  6. Avatar for Paulo Roque 16. Paulo Roque Lv 1 73 pts. 8,304
  7. Avatar for pvc78 17. pvc78 Lv 1 71 pts. 8,304
  8. Avatar for g_b 18. g_b Lv 1 70 pts. 8,299
  9. Avatar for gmn 19. gmn Lv 1 68 pts. 8,299
  10. Avatar for hpaege 20. hpaege Lv 1 66 pts. 8,297

Comments