Foldit

1127: Revisiting Puzzle 87: Zinc Binding Protein

Closed since over 10 years ago

Summary

Created: August 18, 2015
Expires: August 25, 2015 at 11:00 UTC
Max points: 100

Description

This is a throwback puzzle to the early days of Foldit. This small peptide is part of a larger protein that helps to regulate cell division, and is very important in early embryonic development. The protein is modeled here as in a reduced environment, so no disulfide bonds are expected to form. We are revisiting old Foldit puzzles so we can see how useful the recent additions to the game have been.

Sequence:

EKCSEHDERLKLYCKDDGTLSCVICRDSLKHASHNFLPI