Placeholder image of a protein
Icon representing a puzzle

1133: Revisiting Puzzle 89: Cow Eye

Closed since over 10 years ago

Intermediate Intermediate Intermediate Intermediate Intermediate Intermediate Intermediate Intermediate Intermediate Overall Overall Overall Overall Overall Overall Overall Overall Overall Prediction Prediction Prediction Prediction Prediction Prediction Prediction Prediction Prediction

Summary


Created
September 01, 2015
Expires
Max points
100
Description

This is a throwback puzzle to the early days of Foldit. This small domain is part of a larger protein found at high concentrations of the lens of the eye; historically, this protein was purified from the eyes of B. taurus for research. The protein is modeled here in reduced state, so no disulfides are expected to form. We are revisiting old Foldit puzzles so we can see how useful the recent additions to the game have been.



Sequence:

TFRMRIYERDDFRGQMSEITDDCPSLQDRFHLTEVHSLNVLEGSWVLYEMPSYRGRQYLLRPGEYRRYLDWGAMNAKVGSLRRVMDFY

Top groups


  1. Avatar for CureCoin 21. CureCoin 1 pt. 8,223

  1. Avatar for parsnip 191. parsnip Lv 1 1 pt. 8,334
  2. Avatar for karost 192. karost Lv 1 1 pt. 8,315
  3. Avatar for napen123 193. napen123 Lv 1 1 pt. 8,315
  4. Avatar for FoolontheHill24 194. FoolontheHill24 Lv 1 1 pt. 8,294
  5. Avatar for theman007 195. theman007 Lv 1 1 pt. 8,284
  6. Avatar for aspadistra 196. aspadistra Lv 1 1 pt. 8,268
  7. Avatar for KuromiAK 197. KuromiAK Lv 1 1 pt. 8,265
  8. Avatar for thatguy223 198. thatguy223 Lv 1 1 pt. 8,265
  9. Avatar for BrantRundquist 199. BrantRundquist Lv 1 1 pt. 8,256
  10. Avatar for roman madala 200. roman madala Lv 1 1 pt. 8,256

Comments