Placeholder image of a protein
Icon representing a puzzle

1133: Revisiting Puzzle 89: Cow Eye

Closed since over 10 years ago

Intermediate Overall Prediction

Summary


Created
September 01, 2015
Expires
Max points
100
Description

This is a throwback puzzle to the early days of Foldit. This small domain is part of a larger protein found at high concentrations of the lens of the eye; historically, this protein was purified from the eyes of B. taurus for research. The protein is modeled here in reduced state, so no disulfides are expected to form. We are revisiting old Foldit puzzles so we can see how useful the recent additions to the game have been.



Sequence:

TFRMRIYERDDFRGQMSEITDDCPSLQDRFHLTEVHSLNVLEGSWVLYEMPSYRGRQYLLRPGEYRRYLDWGAMNAKVGSLRRVMDFY

Top groups


  1. Avatar for Beta Folders 100 pts. 9,448
  2. Avatar for Contenders 2. Contenders 78 pts. 9,438
  3. Avatar for Go Science 3. Go Science 60 pts. 9,424
  4. Avatar for L'Alliance Francophone 4. L'Alliance Francophone 45 pts. 9,421
  5. Avatar for Deleted group 5. Deleted group pts. 9,413
  6. Avatar for Anthropic Dreams 6. Anthropic Dreams 24 pts. 9,401
  7. Avatar for Gargleblasters 7. Gargleblasters 17 pts. 9,395
  8. Avatar for Void Crushers 8. Void Crushers 12 pts. 9,386
  9. Avatar for HMT heritage 9. HMT heritage 8 pts. 9,338
  10. Avatar for BOINC@Poland 10. BOINC@Poland 6 pts. 9,322

  1. Avatar for parsnip 191. parsnip Lv 1 1 pt. 8,334
  2. Avatar for karost 192. karost Lv 1 1 pt. 8,315
  3. Avatar for napen123 193. napen123 Lv 1 1 pt. 8,315
  4. Avatar for FoolontheHill24 194. FoolontheHill24 Lv 1 1 pt. 8,294
  5. Avatar for theman007 195. theman007 Lv 1 1 pt. 8,284
  6. Avatar for aspadistra 196. aspadistra Lv 1 1 pt. 8,268
  7. Avatar for KuromiAK 197. KuromiAK Lv 1 1 pt. 8,265
  8. Avatar for thatguy223 198. thatguy223 Lv 1 1 pt. 8,265
  9. Avatar for BrantRundquist 199. BrantRundquist Lv 1 1 pt. 8,256
  10. Avatar for roman madala 200. roman madala Lv 1 1 pt. 8,256

Comments