Placeholder image of a protein
Icon representing a puzzle

1133: Revisiting Puzzle 89: Cow Eye

Closed since over 10 years ago

Intermediate Overall Prediction

Summary


Created
September 01, 2015
Expires
Max points
100
Description

This is a throwback puzzle to the early days of Foldit. This small domain is part of a larger protein found at high concentrations of the lens of the eye; historically, this protein was purified from the eyes of B. taurus for research. The protein is modeled here in reduced state, so no disulfides are expected to form. We are revisiting old Foldit puzzles so we can see how useful the recent additions to the game have been.



Sequence:

TFRMRIYERDDFRGQMSEITDDCPSLQDRFHLTEVHSLNVLEGSWVLYEMPSYRGRQYLLRPGEYRRYLDWGAMNAKVGSLRRVMDFY

Top groups


  1. Avatar for CureCoin 21. CureCoin 1 pt. 8,223

  1. Avatar for diamond_dust 31. diamond_dust Lv 1 50 pts. 9,335
  2. Avatar for martin.szew 32. martin.szew Lv 1 49 pts. 9,332
  3. Avatar for pvc78 33. pvc78 Lv 1 47 pts. 9,332
  4. Avatar for cbwest 34. cbwest Lv 1 46 pts. 9,328
  5. Avatar for gloverd 35. gloverd Lv 1 45 pts. 9,326
  6. Avatar for kitek314_pl 36. kitek314_pl Lv 1 44 pts. 9,322
  7. Avatar for gitwut 37. gitwut Lv 1 43 pts. 9,321
  8. Avatar for Idiotboy 38. Idiotboy Lv 1 42 pts. 9,320
  9. Avatar for Anfinsen_slept_here 39. Anfinsen_slept_here Lv 1 41 pts. 9,319
  10. Avatar for reefyrob 40. reefyrob Lv 1 40 pts. 9,316

Comments