Placeholder image of a protein
Icon representing a puzzle

1133: Revisiting Puzzle 89: Cow Eye

Closed since over 10 years ago

Intermediate Overall Prediction

Summary


Created
September 01, 2015
Expires
Max points
100
Description

This is a throwback puzzle to the early days of Foldit. This small domain is part of a larger protein found at high concentrations of the lens of the eye; historically, this protein was purified from the eyes of B. taurus for research. The protein is modeled here in reduced state, so no disulfides are expected to form. We are revisiting old Foldit puzzles so we can see how useful the recent additions to the game have been.



Sequence:

TFRMRIYERDDFRGQMSEITDDCPSLQDRFHLTEVHSLNVLEGSWVLYEMPSYRGRQYLLRPGEYRRYLDWGAMNAKVGSLRRVMDFY

Top groups


  1. Avatar for Beta Folders 100 pts. 9,448
  2. Avatar for Contenders 2. Contenders 78 pts. 9,438
  3. Avatar for Go Science 3. Go Science 60 pts. 9,424
  4. Avatar for L'Alliance Francophone 4. L'Alliance Francophone 45 pts. 9,421
  5. Avatar for Deleted group 5. Deleted group pts. 9,413
  6. Avatar for Anthropic Dreams 6. Anthropic Dreams 24 pts. 9,401
  7. Avatar for Gargleblasters 7. Gargleblasters 17 pts. 9,395
  8. Avatar for Void Crushers 8. Void Crushers 12 pts. 9,386
  9. Avatar for HMT heritage 9. HMT heritage 8 pts. 9,338
  10. Avatar for BOINC@Poland 10. BOINC@Poland 6 pts. 9,322

  1. Avatar for Auntecedent 151. Auntecedent Lv 1 1 pt. 8,756
  2. Avatar for Arne Heessels 152. Arne Heessels Lv 1 1 pt. 8,746
  3. Avatar for dahast.de 153. dahast.de Lv 1 1 pt. 8,742
  4. Avatar for Bletchley Park 154. Bletchley Park Lv 1 1 pt. 8,738
  5. Avatar for silverberg 156. silverberg Lv 1 1 pt. 8,723
  6. Avatar for guineapig 157. guineapig Lv 1 1 pt. 8,722
  7. Avatar for senor pit 158. senor pit Lv 1 1 pt. 8,714
  8. Avatar for Origami314 159. Origami314 Lv 1 1 pt. 8,683
  9. Avatar for pfeiffelfloyd 160. pfeiffelfloyd Lv 1 1 pt. 8,656

Comments