Placeholder image of a protein
Icon representing a puzzle

1136: Revisiting Puzzle 90: Heliomicin

Closed since over 10 years ago

Intermediate Overall Prediction

Summary

Created
September 07, 2015
Expires
Max points
100
Description

This is a throwback puzzle to the early days of Foldit. This small disulfide-rich protein is produced by the moth H. virescens as a defense against certain bacterial and fungal infections. This protein contains six cysteines that oxidize to form three disulfide bonds. We are revisiting old Foldit puzzles so we can see how useful the recent additions to the game have been.



Sequence:

DKLIGSCVWGAVNYTSDCNGECKRRGYKGGHCGSFANVNCWCET

Top groups

  1. Avatar for Natural Abilities 11. Natural Abilities 4 pts. 8,892
  2. Avatar for It's over 9000! 12. It's over 9000! 2 pts. 8,853
  3. Avatar for FoldIt@Netherlands 13. FoldIt@Netherlands 2 pts. 8,836
  4. Avatar for xkcd 14. xkcd 1 pt. 8,725
  5. Avatar for BOINC@Poland 15. BOINC@Poland 1 pt. 8,705
  6. Avatar for Deleted group 16. Deleted group pts. 8,167
  7. Avatar for freefolder 17. freefolder 1 pt. 8,109
  8. Avatar for Deleted group 18. Deleted group pts. 7,689
  9. Avatar for CureCoin 19. CureCoin 1 pt. 7,471
  10. Avatar for DSN @ Home 20. DSN @ Home 1 pt. 7,415
  1. Avatar for GreekCivilization 171. GreekCivilization Lv 1 1 pt. 7,949
  2. Avatar for oaks 172. oaks Lv 1 1 pt. 7,945
  3. Avatar for bperk1005 173. bperk1005 Lv 1 1 pt. 7,945
  4. Avatar for 676 174. 676 Lv 1 1 pt. 7,943
  5. Avatar for Antibrad 175. Antibrad Lv 1 1 pt. 7,936
  6. Avatar for tela 176. tela Lv 1 1 pt. 7,936
  7. Avatar for MrAnderson 177. MrAnderson Lv 1 1 pt. 7,921
  8. Avatar for guineapig 178. guineapig Lv 1 1 pt. 7,921
  9. Avatar for Tyggy Too 179. Tyggy Too Lv 1 1 pt. 7,915
  10. Avatar for clollin 180. clollin Lv 1 1 pt. 7,903

Comments