Placeholder image of a protein
Icon representing a puzzle

1136: Revisiting Puzzle 90: Heliomicin

Closed since over 10 years ago

Intermediate Overall Prediction

Summary


Created
September 07, 2015
Expires
Max points
100
Description

This is a throwback puzzle to the early days of Foldit. This small disulfide-rich protein is produced by the moth H. virescens as a defense against certain bacterial and fungal infections. This protein contains six cysteines that oxidize to form three disulfide bonds. We are revisiting old Foldit puzzles so we can see how useful the recent additions to the game have been.



Sequence:

DKLIGSCVWGAVNYTSDCNGECKRRGYKGGHCGSFANVNCWCET

Top groups



  1. Avatar for harvardman 141. harvardman Lv 1 4 pts. 8,368
  2. Avatar for Vinara 142. Vinara Lv 1 4 pts. 8,347
  3. Avatar for leehaggis 143. leehaggis Lv 1 4 pts. 8,330
  4. Avatar for jebbiek 144. jebbiek Lv 1 3 pts. 8,319
  5. Avatar for pandabearsecond 145. pandabearsecond Lv 1 3 pts. 8,307
  6. Avatar for Merf 146. Merf Lv 1 3 pts. 8,294
  7. Avatar for johngran 147. johngran Lv 1 3 pts. 8,292
  8. Avatar for brgreening 148. brgreening Lv 1 3 pts. 8,291
  9. Avatar for rinze 149. rinze Lv 1 3 pts. 8,242
  10. Avatar for mimo31 150. mimo31 Lv 1 3 pts. 8,224

Comments