Placeholder image of a protein
Icon representing a puzzle

1136: Revisiting Puzzle 90: Heliomicin

Closed since over 10 years ago

Intermediate Overall Prediction

Summary

Created
September 07, 2015
Expires
Max points
100
Description

This is a throwback puzzle to the early days of Foldit. This small disulfide-rich protein is produced by the moth H. virescens as a defense against certain bacterial and fungal infections. This protein contains six cysteines that oxidize to form three disulfide bonds. We are revisiting old Foldit puzzles so we can see how useful the recent additions to the game have been.



Sequence:

DKLIGSCVWGAVNYTSDCNGECKRRGYKGGHCGSFANVNCWCET

Top groups

  1. Avatar for Kramshaw's Genetics Class 21. Kramshaw's Genetics Class 1 pt. 7,138
  1. Avatar for spirogyra 151. spirogyra Lv 1 3 pts. 8,211
  2. Avatar for bwkittitas 152. bwkittitas Lv 1 3 pts. 8,211
  3. Avatar for Jajaboman 153. Jajaboman Lv 1 3 pts. 8,208
  4. Avatar for Amphimixus 154. Amphimixus Lv 1 3 pts. 8,167
  5. Avatar for nbqbio 155. nbqbio Lv 1 2 pts. 8,166
  6. Avatar for dahast.de 156. dahast.de Lv 1 2 pts. 8,152
  7. Avatar for Inkedhands 157. Inkedhands Lv 1 2 pts. 8,144
  8. Avatar for Vincenzo Brancaccio 158. Vincenzo Brancaccio Lv 1 2 pts. 8,137
  9. Avatar for ViJay7019 159. ViJay7019 Lv 1 2 pts. 8,129
  10. Avatar for franse 160. franse Lv 1 2 pts. 8,129

Comments