Placeholder image of a protein
Icon representing a puzzle

1136: Revisiting Puzzle 90: Heliomicin

Closed since over 10 years ago

Intermediate Overall Prediction

Summary


Created
September 07, 2015
Expires
Max points
100
Description

This is a throwback puzzle to the early days of Foldit. This small disulfide-rich protein is produced by the moth H. virescens as a defense against certain bacterial and fungal infections. This protein contains six cysteines that oxidize to form three disulfide bonds. We are revisiting old Foldit puzzles so we can see how useful the recent additions to the game have been.



Sequence:

DKLIGSCVWGAVNYTSDCNGECKRRGYKGGHCGSFANVNCWCET

Top groups



  1. Avatar for Imeturoran 181. Imeturoran Lv 1 1 pt. 7,901
  2. Avatar for FreeFolder 182. FreeFolder Lv 1 1 pt. 7,881
  3. Avatar for hada 183. hada Lv 1 1 pt. 7,878
  4. Avatar for lightnir 184. lightnir Lv 1 1 pt. 7,876
  5. Avatar for roman madala 185. roman madala Lv 1 1 pt. 7,876
  6. Avatar for marcinm611 186. marcinm611 Lv 1 1 pt. 7,874
  7. Avatar for emdee314 187. emdee314 Lv 1 1 pt. 7,869
  8. Avatar for chuckiemc 188. chuckiemc Lv 1 1 pt. 7,840
  9. Avatar for bamh 189. bamh Lv 1 1 pt. 7,834
  10. Avatar for Petrifolder 190. Petrifolder Lv 1 1 pt. 7,799

Comments