Placeholder image of a protein
Icon representing a puzzle

1136: Revisiting Puzzle 90: Heliomicin

Closed since over 10 years ago

Intermediate Overall Prediction

Summary


Created
September 07, 2015
Expires
Max points
100
Description

This is a throwback puzzle to the early days of Foldit. This small disulfide-rich protein is produced by the moth H. virescens as a defense against certain bacterial and fungal infections. This protein contains six cysteines that oxidize to form three disulfide bonds. We are revisiting old Foldit puzzles so we can see how useful the recent additions to the game have been.



Sequence:

DKLIGSCVWGAVNYTSDCNGECKRRGYKGGHCGSFANVNCWCET

Top groups



  1. Avatar for hpaege 11. hpaege Lv 1 84 pts. 9,202
  2. Avatar for reefyrob 12. reefyrob Lv 1 82 pts. 9,198
  3. Avatar for pauldunn 13. pauldunn Lv 1 81 pts. 9,198
  4. Avatar for grogar7 14. grogar7 Lv 1 79 pts. 9,192
  5. Avatar for KarenCH 15. KarenCH Lv 1 78 pts. 9,192
  6. Avatar for nicobul 16. nicobul Lv 1 77 pts. 9,188
  7. Avatar for Skippysk8s 17. Skippysk8s Lv 1 75 pts. 9,183
  8. Avatar for viosca 18. viosca Lv 1 74 pts. 9,176
  9. Avatar for gloverd 19. gloverd Lv 1 72 pts. 9,170
  10. Avatar for Bruno Kestemont 20. Bruno Kestemont Lv 1 71 pts. 9,162

Comments