Placeholder image of a protein
Icon representing a puzzle

1136: Revisiting Puzzle 90: Heliomicin

Closed since over 10 years ago

Intermediate Overall Prediction

Summary

Created
September 07, 2015
Expires
Max points
100
Description

This is a throwback puzzle to the early days of Foldit. This small disulfide-rich protein is produced by the moth H. virescens as a defense against certain bacterial and fungal infections. This protein contains six cysteines that oxidize to form three disulfide bonds. We are revisiting old Foldit puzzles so we can see how useful the recent additions to the game have been.



Sequence:

DKLIGSCVWGAVNYTSDCNGECKRRGYKGGHCGSFANVNCWCET

Top groups

  1. Avatar for Kramshaw's Genetics Class 21. Kramshaw's Genetics Class 1 pt. 7,138
  1. Avatar for BrantRundquist 211. BrantRundquist Lv 1 1 pt. 7,648
  2. Avatar for TigerIII 212. TigerIII Lv 1 1 pt. 7,640
  3. Avatar for enrighea 213. enrighea Lv 1 1 pt. 7,635
  4. Avatar for Simek 214. Simek Lv 1 1 pt. 7,634
  5. Avatar for BlaaackSheep 215. BlaaackSheep Lv 1 1 pt. 7,627
  6. Avatar for vab614 216. vab614 Lv 1 1 pt. 7,626
  7. Avatar for KuromiAK 217. KuromiAK Lv 1 1 pt. 7,626
  8. Avatar for Karth 218. Karth Lv 1 1 pt. 7,611
  9. Avatar for NAFTA2012 219. NAFTA2012 Lv 1 1 pt. 7,610
  10. Avatar for anamika1994 220. anamika1994 Lv 1 1 pt. 7,609

Comments