Placeholder image of a protein
Icon representing a puzzle

1136: Revisiting Puzzle 90: Heliomicin

Closed since over 10 years ago

Intermediate Overall Prediction

Summary

Created
September 07, 2015
Expires
Max points
100
Description

This is a throwback puzzle to the early days of Foldit. This small disulfide-rich protein is produced by the moth H. virescens as a defense against certain bacterial and fungal infections. This protein contains six cysteines that oxidize to form three disulfide bonds. We are revisiting old Foldit puzzles so we can see how useful the recent additions to the game have been.



Sequence:

DKLIGSCVWGAVNYTSDCNGECKRRGYKGGHCGSFANVNCWCET

Top groups

  1. Avatar for Kramshaw's Genetics Class 21. Kramshaw's Genetics Class 1 pt. 7,138
  1. Avatar for Susume 271. Susume Lv 1 1 pt. 0
  2. Avatar for Eyal.Eliezer 272. Eyal.Eliezer Lv 1 1 pt. 0
  3. Avatar for packer 273. packer Lv 1 1 pt. 0
  4. Avatar for heather-1 274. heather-1 Lv 1 1 pt. 0
  5. Avatar for Vertox 275. Vertox Lv 1 1 pt. 0
  6. Avatar for pandapharmd 276. pandapharmd Lv 1 1 pt. 0
  7. Avatar for basas 277. basas Lv 1 1 pt. 0
  8. Avatar for Deleted player 278. Deleted player pts. 0
  9. Avatar for Regulum 279. Regulum Lv 1 1 pt. 0
  10. Avatar for agnairt 280. agnairt Lv 1 1 pt. 0

Comments