Placeholder image of a protein
Icon representing a puzzle

1136: Revisiting Puzzle 90: Heliomicin

Closed since over 10 years ago

Intermediate Overall Prediction

Summary


Created
September 07, 2015
Expires
Max points
100
Description

This is a throwback puzzle to the early days of Foldit. This small disulfide-rich protein is produced by the moth H. virescens as a defense against certain bacterial and fungal infections. This protein contains six cysteines that oxidize to form three disulfide bonds. We are revisiting old Foldit puzzles so we can see how useful the recent additions to the game have been.



Sequence:

DKLIGSCVWGAVNYTSDCNGECKRRGYKGGHCGSFANVNCWCET

Top groups



  1. Avatar for O Seki To 31. O Seki To Lv 1 57 pts. 9,107
  2. Avatar for Vredeman 32. Vredeman Lv 1 56 pts. 9,100
  3. Avatar for Blipperman 33. Blipperman Lv 1 55 pts. 9,091
  4. Avatar for smilingone 34. smilingone Lv 1 54 pts. 9,088
  5. Avatar for christioanchauvin 35. christioanchauvin Lv 1 53 pts. 9,088
  6. Avatar for jermainiac 36. jermainiac Lv 1 52 pts. 9,078
  7. Avatar for dcrwheeler 37. dcrwheeler Lv 1 51 pts. 9,077
  8. Avatar for brow42 38. brow42 Lv 1 50 pts. 9,068
  9. Avatar for nemo7731 39. nemo7731 Lv 1 49 pts. 9,065
  10. Avatar for WonkyDonkey 40. WonkyDonkey Lv 1 48 pts. 9,058

Comments