Placeholder image of a protein
Icon representing a puzzle

1136: Revisiting Puzzle 90: Heliomicin

Closed since over 10 years ago

Intermediate Overall Prediction

Summary

Created
September 07, 2015
Expires
Max points
100
Description

This is a throwback puzzle to the early days of Foldit. This small disulfide-rich protein is produced by the moth H. virescens as a defense against certain bacterial and fungal infections. This protein contains six cysteines that oxidize to form three disulfide bonds. We are revisiting old Foldit puzzles so we can see how useful the recent additions to the game have been.



Sequence:

DKLIGSCVWGAVNYTSDCNGECKRRGYKGGHCGSFANVNCWCET

Top groups

  1. Avatar for Kramshaw's Genetics Class 21. Kramshaw's Genetics Class 1 pt. 7,138
  1. Avatar for shettler 41. shettler Lv 1 47 pts. 9,055
  2. Avatar for martin.szew 42. martin.szew Lv 1 46 pts. 9,053
  3. Avatar for crpainter 43. crpainter Lv 1 45 pts. 9,053
  4. Avatar for sharondipity 44. sharondipity Lv 1 44 pts. 9,051
  5. Avatar for cbwest 45. cbwest Lv 1 43 pts. 9,044
  6. Avatar for Idiotboy 46. Idiotboy Lv 1 42 pts. 9,038
  7. Avatar for deLaCeiba 47. deLaCeiba Lv 1 42 pts. 9,037
  8. Avatar for drumpeter18yrs9yrs 48. drumpeter18yrs9yrs Lv 1 41 pts. 9,033
  9. Avatar for uhuuhu 49. uhuuhu Lv 1 40 pts. 9,031
  10. Avatar for jamiexq 50. jamiexq Lv 1 39 pts. 9,031

Comments