Placeholder image of a protein
Icon representing a puzzle

1136: Revisiting Puzzle 90: Heliomicin

Closed since over 10 years ago

Intermediate Overall Prediction

Summary

Created
September 07, 2015
Expires
Max points
100
Description

This is a throwback puzzle to the early days of Foldit. This small disulfide-rich protein is produced by the moth H. virescens as a defense against certain bacterial and fungal infections. This protein contains six cysteines that oxidize to form three disulfide bonds. We are revisiting old Foldit puzzles so we can see how useful the recent additions to the game have been.



Sequence:

DKLIGSCVWGAVNYTSDCNGECKRRGYKGGHCGSFANVNCWCET

Top groups

  1. Avatar for Kramshaw's Genetics Class 21. Kramshaw's Genetics Class 1 pt. 7,138
  1. Avatar for dettingen 61. dettingen Lv 1 31 pts. 8,976
  2. Avatar for Museka 62. Museka Lv 1 30 pts. 8,974
  3. Avatar for diamond_dust 63. diamond_dust Lv 1 29 pts. 8,973
  4. Avatar for gurch 64. gurch Lv 1 29 pts. 8,973
  5. Avatar for pmthomson90 65. pmthomson90 Lv 1 28 pts. 8,973
  6. Avatar for pizpot 66. pizpot Lv 1 27 pts. 8,965
  7. Avatar for t012 67. t012 Lv 1 27 pts. 8,961
  8. Avatar for caglar 68. caglar Lv 1 26 pts. 8,958
  9. Avatar for YeshuaLives 69. YeshuaLives Lv 1 26 pts. 8,958
  10. Avatar for AryehK 70. AryehK Lv 1 25 pts. 8,955

Comments