Placeholder image of a protein
Icon representing a puzzle

1136: Revisiting Puzzle 90: Heliomicin

Closed since over 10 years ago

Intermediate Overall Prediction

Summary

Created
September 07, 2015
Expires
Max points
100
Description

This is a throwback puzzle to the early days of Foldit. This small disulfide-rich protein is produced by the moth H. virescens as a defense against certain bacterial and fungal infections. This protein contains six cysteines that oxidize to form three disulfide bonds. We are revisiting old Foldit puzzles so we can see how useful the recent additions to the game have been.



Sequence:

DKLIGSCVWGAVNYTSDCNGECKRRGYKGGHCGSFANVNCWCET

Top groups

  1. Avatar for Kramshaw's Genetics Class 21. Kramshaw's Genetics Class 1 pt. 7,138
  1. Avatar for Tweedle Dumb 81. Tweedle Dumb Lv 1 19 pts. 8,872
  2. Avatar for arcsign 82. arcsign Lv 1 19 pts. 8,864
  3. Avatar for smholst 83. smholst Lv 1 18 pts. 8,861
  4. Avatar for BCAA 84. BCAA Lv 1 18 pts. 8,853
  5. Avatar for Paulo Roque 85. Paulo Roque Lv 1 18 pts. 8,837
  6. Avatar for molleke 86. molleke Lv 1 17 pts. 8,836
  7. Avatar for Norrjane 87. Norrjane Lv 1 17 pts. 8,830
  8. Avatar for Glen B 88. Glen B Lv 1 16 pts. 8,810
  9. Avatar for manu8170 89. manu8170 Lv 1 16 pts. 8,803
  10. Avatar for gdnskye 90. gdnskye Lv 1 16 pts. 8,780

Comments