Placeholder image of a protein
Icon representing a puzzle

1136: Revisiting Puzzle 90: Heliomicin

Closed since over 10 years ago

Intermediate Intermediate Intermediate Intermediate Intermediate Intermediate Intermediate Intermediate Intermediate Intermediate Overall Overall Overall Overall Overall Overall Overall Overall Overall Overall Prediction Prediction Prediction Prediction Prediction Prediction Prediction Prediction Prediction Prediction

Summary


Created
September 07, 2015
Expires
Max points
100
Description

This is a throwback puzzle to the early days of Foldit. This small disulfide-rich protein is produced by the moth H. virescens as a defense against certain bacterial and fungal infections. This protein contains six cysteines that oxidize to form three disulfide bonds. We are revisiting old Foldit puzzles so we can see how useful the recent additions to the game have been.



Sequence:

DKLIGSCVWGAVNYTSDCNGECKRRGYKGGHCGSFANVNCWCET

Top groups


  1. Avatar for Anthropic Dreams 100 pts. 9,266
  2. Avatar for Beta Folders 2. Beta Folders 78 pts. 9,249
  3. Avatar for Gargleblasters 3. Gargleblasters 60 pts. 9,231
  4. Avatar for Contenders 4. Contenders 45 pts. 9,221
  5. Avatar for Void Crushers 5. Void Crushers 33 pts. 9,207
  6. Avatar for Go Science 6. Go Science 24 pts. 9,202
  7. Avatar for L'Alliance Francophone 7. L'Alliance Francophone 17 pts. 9,188
  8. Avatar for Deleted group 8. Deleted group pts. 9,155
  9. Avatar for HMT heritage 9. HMT heritage 8 pts. 9,107
  10. Avatar for Italiani Al Lavoro 10. Italiani Al Lavoro 6 pts. 9,037

  1. Avatar for Colostomy EXPLOSION. 121. Colostomy EXPLOSION. Lv 1 7 pts. 8,573
  2. Avatar for morris3190 122. morris3190 Lv 1 7 pts. 8,556
  3. Avatar for Wheeler22 123. Wheeler22 Lv 1 6 pts. 8,555
  4. Avatar for sheerbliss 124. sheerbliss Lv 1 6 pts. 8,546
  5. Avatar for navn 125. navn Lv 1 6 pts. 8,542
  6. Avatar for 01010011111 126. 01010011111 Lv 1 6 pts. 8,535
  7. Avatar for petetrig 127. petetrig Lv 1 6 pts. 8,523
  8. Avatar for Iron pet 128. Iron pet Lv 1 6 pts. 8,500
  9. Avatar for greepski 129. greepski Lv 1 5 pts. 8,484
  10. Avatar for Festering Wounds 130. Festering Wounds Lv 1 5 pts. 8,468

Comments