Placeholder image of a protein
Icon representing a puzzle

1136: Revisiting Puzzle 90: Heliomicin

Closed since over 10 years ago

Intermediate Overall Prediction

Summary


Created
September 07, 2015
Expires
Max points
100
Description

This is a throwback puzzle to the early days of Foldit. This small disulfide-rich protein is produced by the moth H. virescens as a defense against certain bacterial and fungal infections. This protein contains six cysteines that oxidize to form three disulfide bonds. We are revisiting old Foldit puzzles so we can see how useful the recent additions to the game have been.



Sequence:

DKLIGSCVWGAVNYTSDCNGECKRRGYKGGHCGSFANVNCWCET

Top groups


  1. Avatar for Anthropic Dreams 100 pts. 9,266
  2. Avatar for Beta Folders 2. Beta Folders 78 pts. 9,249
  3. Avatar for Gargleblasters 3. Gargleblasters 60 pts. 9,231
  4. Avatar for Contenders 4. Contenders 45 pts. 9,221
  5. Avatar for Void Crushers 5. Void Crushers 33 pts. 9,207
  6. Avatar for Go Science 6. Go Science 24 pts. 9,202
  7. Avatar for L'Alliance Francophone 7. L'Alliance Francophone 17 pts. 9,188
  8. Avatar for Deleted group 8. Deleted group pts. 9,155
  9. Avatar for HMT heritage 9. HMT heritage 8 pts. 9,107
  10. Avatar for Italiani Al Lavoro 10. Italiani Al Lavoro 6 pts. 9,037

  1. Avatar for goastano 91. goastano Lv 1 15 pts. 8,770
  2. Avatar for Deleted player 92. Deleted player pts. 8,768
  3. Avatar for WBarme1234 93. WBarme1234 Lv 1 14 pts. 8,767
  4. Avatar for RockOn 94. RockOn Lv 1 14 pts. 8,750
  5. Avatar for SKSbell 95. SKSbell Lv 1 14 pts. 8,740
  6. Avatar for fryguy 96. fryguy Lv 1 13 pts. 8,725
  7. Avatar for kitek314_pl 97. kitek314_pl Lv 1 13 pts. 8,705
  8. Avatar for alwen 98. alwen Lv 1 13 pts. 8,698
  9. Avatar for Pro Lapser 99. Pro Lapser Lv 1 12 pts. 8,694
  10. Avatar for Soggy Doglog 100. Soggy Doglog Lv 1 12 pts. 8,688

Comments