1136: Revisiting Puzzle 90: Heliomicin

Closed since over 10 years ago

Summary

• Created: September 07, 2015
• Expires: September 16, 2015 at 11:00 UTC
• Max points: 100

Description

This is a throwback puzzle to the early days of Foldit. This small disulfide-rich protein is produced by the moth H. virescens as a defense against certain bacterial and fungal infections. This protein contains six cysteines that oxidize to form three disulfide bonds. We are revisiting old Foldit puzzles so we can see how useful the recent additions to the game have been.



Sequence:

DKLIGSCVWGAVNYTSDCNGECKRRGYKGGHCGSFANVNCWCET

Top groups

• 1. Anthropic Dreams 100 pts. 9,266
• 2. Beta Folders 78 pts. 9,249
• 3. Gargleblasters 60 pts. 9,231
• 4. Contenders 45 pts. 9,221
• 5. Void Crushers 33 pts. 9,207
• 6. Go Science 24 pts. 9,202
• 7. L'Alliance Francophone 17 pts. 9,188
• 8. Deleted group pts. 9,155
• 9. HMT heritage 8 pts. 9,107
• 10. Italiani Al Lavoro 6 pts. 9,037

Top soloists

• 51. Deleted player 38 pts. 9,030
• 52. stomjoh 37 pts. 9,030
• 53. Anfinsen_slept_here 37 pts. 9,028
• 54. Mike Cassidy 36 pts. 9,024
• 55. pvc78 35 pts. 9,017
• 56. joremen 34 pts. 9,008
• 57. jdormaar 34 pts. 9,004
• 58. lilovip 33 pts. 8,996
• 59. TomTaylor 32 pts. 8,994
• 60. andrewxc 31 pts. 8,994