1139: Revisiting Puzzle 91: Virus Protein
Closed since over 10 years ago
Intermediate Intermediate Intermediate Intermediate Overall Overall Overall Overall Prediction Prediction Prediction PredictionSummary
- Created
- September 15, 2015
- Expires
- Max points
- 100
This is a throwback puzzle to the early days of Foldit. This protein is found on the surface of bacteriophage fd, a virus that infects E. coli. It is responsible for penetrating the cell membrane of the host bacteria, allowing virus to enter the cell. This protein contains four cysteines that oxidize to form two disulfide bonds. We are revisiting old Foldit puzzles so we can see how useful the recent additions to the game have been.
Sequence:
ETVESCLAKPHTENSFTNVWKDDKTLDRYANYEGCLWNATGVVVCTGDETQCYGTWVPIGLAIPENAAAH