Placeholder image of a protein
Icon representing a puzzle

1139: Revisiting Puzzle 91: Virus Protein

Closed since over 10 years ago

Intermediate Overall Prediction

Summary

Created
September 15, 2015
Expires
Max points
100
Description

This is a throwback puzzle to the early days of Foldit. This protein is found on the surface of bacteriophage fd, a virus that infects E. coli. It is responsible for penetrating the cell membrane of the host bacteria, allowing virus to enter the cell. This protein contains four cysteines that oxidize to form two disulfide bonds. We are revisiting old Foldit puzzles so we can see how useful the recent additions to the game have been.



Sequence:


ETVESCLAKPHTENSFTNVWKDDKTLDRYANYEGCLWNATGVVVCTGDETQCYGTWVPIGLAIPENAAAH

Top groups

  1. Avatar for BOINC@Poland 11. BOINC@Poland 5 pts. 8,695
  2. Avatar for xkcd 12. xkcd 4 pts. 8,592
  3. Avatar for FoldIt@Netherlands 13. FoldIt@Netherlands 2 pts. 8,590
  4. Avatar for It's over 9000! 14. It's over 9000! 2 pts. 8,384
  5. Avatar for Natural Abilities 15. Natural Abilities 1 pt. 8,318
  6. Avatar for Androids 16. Androids 1 pt. 7,888
  7. Avatar for freefolder 17. freefolder 1 pt. 7,257
  8. Avatar for CureCoin 18. CureCoin 1 pt. 7,051
  9. Avatar for DSN @ Home 19. DSN @ Home 1 pt. 7,022
  10. Avatar for EVHS AP Biology 20. EVHS AP Biology 1 pt. 6,804
  1. Avatar for F234 161. F234 Lv 1 2 pts. 7,694
  2. Avatar for Inkedhands 162. Inkedhands Lv 1 2 pts. 7,676
  3. Avatar for jebbiek 163. jebbiek Lv 1 2 pts. 7,666
  4. Avatar for multaq 164. multaq Lv 1 2 pts. 7,617
  5. Avatar for Jajaboman 165. Jajaboman Lv 1 2 pts. 7,608
  6. Avatar for martinf 166. martinf Lv 1 1 pt. 7,606
  7. Avatar for rokenbok411 167. rokenbok411 Lv 1 1 pt. 7,592
  8. Avatar for ChinaSESsolve 168. ChinaSESsolve Lv 1 1 pt. 7,591
  9. Avatar for DerpDragon 169. DerpDragon Lv 1 1 pt. 7,576
  10. Avatar for carmel4a 170. carmel4a Lv 1 1 pt. 7,575

Comments