Placeholder image of a protein
Icon representing a puzzle

1139: Revisiting Puzzle 91: Virus Protein

Closed since over 10 years ago

Intermediate Overall Prediction

Summary


Created
September 15, 2015
Expires
Max points
100
Description

This is a throwback puzzle to the early days of Foldit. This protein is found on the surface of bacteriophage fd, a virus that infects E. coli. It is responsible for penetrating the cell membrane of the host bacteria, allowing virus to enter the cell. This protein contains four cysteines that oxidize to form two disulfide bonds. We are revisiting old Foldit puzzles so we can see how useful the recent additions to the game have been.



Sequence:


ETVESCLAKPHTENSFTNVWKDDKTLDRYANYEGCLWNATGVVVCTGDETQCYGTWVPIGLAIPENAAAH

Top groups


  1. Avatar for BOINC@Poland 11. BOINC@Poland 5 pts. 8,695
  2. Avatar for xkcd 12. xkcd 4 pts. 8,592
  3. Avatar for FoldIt@Netherlands 13. FoldIt@Netherlands 2 pts. 8,590
  4. Avatar for It's over 9000! 14. It's over 9000! 2 pts. 8,384
  5. Avatar for Natural Abilities 15. Natural Abilities 1 pt. 8,318
  6. Avatar for Androids 16. Androids 1 pt. 7,888
  7. Avatar for freefolder 17. freefolder 1 pt. 7,257
  8. Avatar for CureCoin 18. CureCoin 1 pt. 7,051
  9. Avatar for DSN @ Home 19. DSN @ Home 1 pt. 7,022
  10. Avatar for EVHS AP Biology 20. EVHS AP Biology 1 pt. 6,804

  1. Avatar for Aldrovanda 181. Aldrovanda Lv 1 1 pt. 7,489
  2. Avatar for Heavenly Touch 182. Heavenly Touch Lv 1 1 pt. 7,488
  3. Avatar for cherry39 183. cherry39 Lv 1 1 pt. 7,469
  4. Avatar for boondog 184. boondog Lv 1 1 pt. 7,444
  5. Avatar for pandabearsecond 185. pandabearsecond Lv 1 1 pt. 7,442
  6. Avatar for Wheeler22 186. Wheeler22 Lv 1 1 pt. 7,440
  7. Avatar for monkry 187. monkry Lv 1 1 pt. 7,439
  8. Avatar for Silesian 188. Silesian Lv 1 1 pt. 7,428
  9. Avatar for 01010011111 189. 01010011111 Lv 1 1 pt. 7,415
  10. Avatar for NotJim99 190. NotJim99 Lv 1 1 pt. 7,413

Comments