Placeholder image of a protein
Icon representing a puzzle

1139: Revisiting Puzzle 91: Virus Protein

Closed since over 10 years ago

Intermediate Intermediate Overall Overall Prediction Prediction

Summary


Created
September 15, 2015
Expires
Max points
100
Description

This is a throwback puzzle to the early days of Foldit. This protein is found on the surface of bacteriophage fd, a virus that infects E. coli. It is responsible for penetrating the cell membrane of the host bacteria, allowing virus to enter the cell. This protein contains four cysteines that oxidize to form two disulfide bonds. We are revisiting old Foldit puzzles so we can see how useful the recent additions to the game have been.



Sequence:


ETVESCLAKPHTENSFTNVWKDDKTLDRYANYEGCLWNATGVVVCTGDETQCYGTWVPIGLAIPENAAAH

Top groups


  1. Avatar for Firebirds BioChem 21. Firebirds BioChem 1 pt. 6,423
  2. Avatar for DIE-CINVESTAV 22. DIE-CINVESTAV 1 pt. 5,707
  3. Avatar for Russian team 23. Russian team 1 pt. 3,306

  1. Avatar for frood66
    1. frood66 Lv 1
    100 pts. 9,321
  2. Avatar for BitSpawn 2. BitSpawn Lv 1 99 pts. 9,270
  3. Avatar for LociOiling 3. LociOiling Lv 1 97 pts. 9,221
  4. Avatar for Skippysk8s 4. Skippysk8s Lv 1 95 pts. 9,208
  5. Avatar for actiasluna 5. actiasluna Lv 1 93 pts. 9,204
  6. Avatar for mirp 6. mirp Lv 1 92 pts. 9,196
  7. Avatar for pauldunn 7. pauldunn Lv 1 90 pts. 9,185
  8. Avatar for Deleted player 8. Deleted player pts. 9,174
  9. Avatar for gmn 9. gmn Lv 1 87 pts. 9,170
  10. Avatar for viosca 10. viosca Lv 1 85 pts. 9,168

Comments